Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
Location | 4357337..4358016 | Replicon | chromosome |
Accession | NZ_CP110775 | ||
Organism | Citrobacter freundii strain Cf-Emp |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A1B7JLK7 |
Locus tag | OPR78_RS21490 | Protein ID | WP_003031349.1 |
Coordinates | 4357337..4357678 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yafW | Uniprot ID | A0A1B7JLJ2 |
Locus tag | OPR78_RS21495 | Protein ID | WP_003031347.1 |
Coordinates | 4357699..4358016 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OPR78_RS21465 (4352462) | 4352462..4352815 | + | 354 | WP_016239889.1 | hypothetical protein | - |
OPR78_RS21470 (4352816) | 4352816..4354015 | + | 1200 | WP_121927013.1 | baseplate J/gp47 family protein | - |
OPR78_RS21475 (4354012) | 4354012..4354692 | + | 681 | WP_121927014.1 | DUF2612 domain-containing protein | - |
OPR78_RS21480 (4354692) | 4354692..4356143 | + | 1452 | WP_224770544.1 | hypothetical protein | - |
OPR78_RS21485 (4356145) | 4356145..4356747 | + | 603 | WP_224770543.1 | tail fiber assembly protein | - |
OPR78_RS21490 (4357337) | 4357337..4357678 | - | 342 | WP_003031349.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
OPR78_RS21495 (4357699) | 4357699..4358016 | - | 318 | WP_003031347.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
OPR78_RS21500 (4358034) | 4358034..4358255 | - | 222 | WP_003031346.1 | DUF987 domain-containing protein | - |
OPR78_RS21505 (4358264) | 4358264..4358740 | - | 477 | WP_003031345.1 | RadC family protein | - |
OPR78_RS21510 (4358756) | 4358756..4359217 | - | 462 | WP_003031344.1 | antirestriction protein | - |
OPR78_RS21515 (4359926) | 4359926..4361923 | + | 1998 | WP_016245729.1 | choline BCCT transporter BetT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4314880..4359217 | 44337 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12921.01 Da Isoelectric Point: 9.6543
>T264212 WP_003031349.1 NZ_CP110775:c4357678-4357337 [Citrobacter freundii]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JLK7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B7JLJ2 |