Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3869576..3870092 | Replicon | chromosome |
Accession | NZ_CP110775 | ||
Organism | Citrobacter freundii strain Cf-Emp |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OPR78_RS19125 | Protein ID | WP_044699148.1 |
Coordinates | 3869808..3870092 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A0J1MV10 |
Locus tag | OPR78_RS19120 | Protein ID | WP_003839576.1 |
Coordinates | 3869576..3869818 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OPR78_RS19100 (3864591) | 3864591..3865724 | + | 1134 | WP_016149471.1 | amidohydrolase/deacetylase family metallohydrolase | - |
OPR78_RS19105 (3865708) | 3865708..3866826 | + | 1119 | WP_044699152.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
OPR78_RS19110 (3866823) | 3866823..3867563 | + | 741 | WP_044699149.1 | KDGP aldolase family protein | - |
OPR78_RS19115 (3867585) | 3867585..3869498 | + | 1914 | WP_003839574.1 | BglG family transcription antiterminator | - |
OPR78_RS19120 (3869576) | 3869576..3869818 | + | 243 | WP_003839576.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OPR78_RS19125 (3869808) | 3869808..3870092 | + | 285 | WP_044699148.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OPR78_RS19130 (3870096) | 3870096..3870560 | - | 465 | WP_032937736.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OPR78_RS19135 (3870667) | 3870667..3872805 | - | 2139 | WP_003025782.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OPR78_RS19140 (3873183) | 3873183..3873767 | - | 585 | WP_003839584.1 | fructose PTS transporter subunit IIA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10865.69 Da Isoelectric Point: 10.1988
>T264211 WP_044699148.1 NZ_CP110775:3869808-3870092 [Citrobacter freundii]
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
RQHSAVYLDANKRL
MTYELEFDPRALKEWHKLGDTVKAQFKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDEVVTVFVVAVGK
RQHSAVYLDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|