Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/COG5606-COG4679 |
| Location | 3613294..3613960 | Replicon | chromosome |
| Accession | NZ_CP110775 | ||
| Organism | Citrobacter freundii strain Cf-Emp | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | A0A0D7LIM5 |
| Locus tag | OPR78_RS17905 | Protein ID | WP_044702260.1 |
| Coordinates | 3613294..3613653 (+) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | A0A0D7LIR0 |
| Locus tag | OPR78_RS17910 | Protein ID | WP_003844682.1 |
| Coordinates | 3613643..3613960 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OPR78_RS17895 (3610694) | 3610694..3612325 | + | 1632 | WP_032938230.1 | Na/Pi cotransporter family protein | - |
| OPR78_RS17900 (3612391) | 3612391..3613080 | - | 690 | WP_003841421.1 | dipeptidase PepE | - |
| OPR78_RS17905 (3613294) | 3613294..3613653 | + | 360 | WP_044702260.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OPR78_RS17910 (3613643) | 3613643..3613960 | + | 318 | WP_003844682.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| OPR78_RS17915 (3613970) | 3613970..3614248 | - | 279 | WP_044702262.1 | putative addiction module antidote protein | - |
| OPR78_RS17920 (3614652) | 3614652..3614813 | - | 162 | WP_003841416.1 | phage protein | - |
| OPR78_RS17925 (3614955) | 3614955..3615311 | + | 357 | WP_032948294.1 | hypothetical protein | - |
| OPR78_RS17930 (3615363) | 3615363..3616175 | - | 813 | WP_044702264.1 | shikimate 5-dehydrogenase | - |
| OPR78_RS17935 (3616177) | 3616177..3617400 | - | 1224 | WP_044702265.1 | L-sorbose 1-phosphate reductase | - |
| OPR78_RS17940 (3617469) | 3617469..3618293 | - | 825 | WP_003031641.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13437.49 Da Isoelectric Point: 10.2555
>T264210 WP_044702260.1 NZ_CP110775:3613294-3613653 [Citrobacter freundii]
MTKPLYWVGQARKDLIAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
MTKPLYWVGQARKDLIAMPEHVRDTFGFALWLAQQGKQHSQTKPLKGFGGAGVLEVVEDYHGNAWRAVYTIQLKNAVYVL
HVFQKKSVSGKATPKPEIDLIYQRLKAAQRHAQESGYVT
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D7LIM5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0D7LIR0 |