Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 3461410..3462026 | Replicon | chromosome |
Accession | NZ_CP110775 | ||
Organism | Citrobacter freundii strain Cf-Emp |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A0J1MQ96 |
Locus tag | OPR78_RS17220 | Protein ID | WP_003028682.1 |
Coordinates | 3461652..3462026 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6B5NTK4 |
Locus tag | OPR78_RS17215 | Protein ID | WP_043018956.1 |
Coordinates | 3461410..3461652 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OPR78_RS17190 (3457260) | 3457260..3457859 | + | 600 | WP_016151258.1 | glucose-1-phosphatase | - |
OPR78_RS17195 (3457853) | 3457853..3458725 | + | 873 | WP_003028669.1 | virulence factor BrkB family protein | - |
OPR78_RS17200 (3458722) | 3458722..3459159 | + | 438 | WP_003028671.1 | D-aminoacyl-tRNA deacylase | - |
OPR78_RS17205 (3459204) | 3459204..3460145 | + | 942 | WP_003825286.1 | fatty acid biosynthesis protein FabY | - |
OPR78_RS17210 (3460296) | 3460296..3461204 | - | 909 | WP_044701816.1 | alpha/beta hydrolase | - |
OPR78_RS17215 (3461410) | 3461410..3461652 | + | 243 | WP_043018956.1 | CopG family transcriptional regulator | Antitoxin |
OPR78_RS17220 (3461652) | 3461652..3462026 | + | 375 | WP_003028682.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OPR78_RS17225 (3462063) | 3462063..3462992 | - | 930 | WP_003028685.1 | formate dehydrogenase accessory protein FdhE | - |
OPR78_RS17230 (3462989) | 3462989..3463624 | - | 636 | WP_003028686.1 | formate dehydrogenase cytochrome b556 subunit | - |
OPR78_RS17235 (3463621) | 3463621..3464523 | - | 903 | WP_003028691.1 | formate dehydrogenase O subunit beta | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13674.89 Da Isoelectric Point: 9.5622
>T264209 WP_003028682.1 NZ_CP110775:3461652-3462026 [Citrobacter freundii]
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
MVKGSALFDTNILIDLFSGRNEAKLAIETWPPQNAISLITWMEVMVGAKKYHQEARTRVALGAFNVIGVSQDIAERSVSI
RQEYGMKLPDAIILATAQIHRLTLVTRNTKDFAGLSGVVTPYTL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MQ96 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B5NTK4 |