Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/- |
Location | 2985070..2985701 | Replicon | chromosome |
Accession | NZ_CP110775 | ||
Organism | Citrobacter freundii strain Cf-Emp |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0J1MPQ6 |
Locus tag | OPR78_RS14970 | Protein ID | WP_003837806.1 |
Coordinates | 2985426..2985701 (-) | Length | 92 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A0J1MMS0 |
Locus tag | OPR78_RS14965 | Protein ID | WP_003837808.1 |
Coordinates | 2985070..2985429 (-) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OPR78_RS14935 (2980168) | 2980168..2980833 | + | 666 | WP_044701371.1 | 7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter | - |
OPR78_RS14940 (2980906) | 2980906..2981463 | + | 558 | WP_003837816.1 | DcrB family lipoprotein | - |
OPR78_RS14945 (2981467) | 2981467..2982684 | - | 1218 | WP_003846164.1 | MFS transporter | - |
OPR78_RS14950 (2982818) | 2982818..2983867 | + | 1050 | WP_003023393.1 | AI-2E family transporter | - |
OPR78_RS14955 (2983930) | 2983930..2984508 | + | 579 | WP_003837810.1 | 4'-phosphopantetheinyl transferase AcpT | - |
OPR78_RS14960 (2984558) | 2984558..2984959 | + | 402 | WP_003023387.1 | nickel-responsive transcriptional regulator NikR | - |
OPR78_RS14965 (2985070) | 2985070..2985429 | - | 360 | WP_003837808.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OPR78_RS14970 (2985426) | 2985426..2985701 | - | 276 | WP_003837806.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OPR78_RS14975 (2985779) | 2985779..2986903 | - | 1125 | WP_003837801.1 | ABC transporter permease | - |
OPR78_RS14980 (2986903) | 2986903..2989650 | - | 2748 | WP_044701369.1 | ribosome-associated ATPase/putative transporter RbbA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10210.88 Da Isoelectric Point: 10.7228
>T264207 WP_003837806.1 NZ_CP110775:c2985701-2985426 [Citrobacter freundii]
MKEKVLSLRKKQKNTLDQLFKAPTPQGIKWSEIESLIKALGGEIKEGRGSRCKFLLNKSIASFHRPHPSPDTDKGAVENV
RDWLTSIGVKP
MKEKVLSLRKKQKNTLDQLFKAPTPQGIKWSEIESLIKALGGEIKEGRGSRCKFLLNKSIASFHRPHPSPDTDKGAVENV
RDWLTSIGVKP
Download Length: 276 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13198.98 Da Isoelectric Point: 4.5462
>AT264207 WP_003837808.1 NZ_CP110775:c2985429-2985070 [Citrobacter freundii]
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGEISLREYLDDCSAAGIEPYANPEKLKT
FTLRYPESFGERLSFAAAEEQVSVNTWIIETLSKSLKQA
MIKPKTPNSMEIAGQPAVINYVPELNAFRGKFLGLSGYCDFVSDSIQGLQKEGEISLREYLDDCSAAGIEPYANPEKLKT
FTLRYPESFGERLSFAAAEEQVSVNTWIIETLSKSLKQA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MPQ6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J1MMS0 |