Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2404943..2405597 | Replicon | chromosome |
| Accession | NZ_CP110775 | ||
| Organism | Citrobacter freundii strain Cf-Emp | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0J1NHY7 |
| Locus tag | OPR78_RS12010 | Protein ID | WP_003026936.1 |
| Coordinates | 2404943..2405350 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A6H3AT26 |
| Locus tag | OPR78_RS12015 | Protein ID | WP_003026938.1 |
| Coordinates | 2405331..2405597 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OPR78_RS11990 (2400891) | 2400891..2402624 | - | 1734 | WP_044700800.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| OPR78_RS11995 (2402630) | 2402630..2403343 | - | 714 | WP_003026923.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OPR78_RS12000 (2403367) | 2403367..2404263 | - | 897 | WP_003026928.1 | site-specific tyrosine recombinase XerD | - |
| OPR78_RS12005 (2404377) | 2404377..2404898 | + | 522 | WP_003026933.1 | flavodoxin FldB | - |
| OPR78_RS12010 (2404943) | 2404943..2405350 | - | 408 | WP_003026936.1 | protein YgfX | Toxin |
| OPR78_RS12015 (2405331) | 2405331..2405597 | - | 267 | WP_003026938.1 | FAD assembly factor SdhE | Antitoxin |
| OPR78_RS12020 (2405854) | 2405854..2406834 | + | 981 | WP_003026944.1 | tRNA-modifying protein YgfZ | - |
| OPR78_RS12025 (2406928) | 2406928..2407587 | - | 660 | WP_003838267.1 | hemolysin III family protein | - |
| OPR78_RS12030 (2407750) | 2407750..2408061 | - | 312 | WP_044700802.1 | N(4)-acetylcytidine aminohydrolase | - |
| OPR78_RS12035 (2408114) | 2408114..2408842 | + | 729 | WP_003838265.1 | MurR/RpiR family transcriptional regulator | - |
| OPR78_RS12040 (2408963) | 2408963..2410396 | + | 1434 | WP_044700805.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15953.89 Da Isoelectric Point: 11.4054
>T264205 WP_003026936.1 NZ_CP110775:c2405350-2404943 [Citrobacter freundii]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVSAPWMVKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQKAKQK
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J1NHY7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6H3AT26 |