Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
Location | 3354077..3354804 | Replicon | chromosome |
Accession | NZ_CP110774 | ||
Organism | Acidocella sp. MX-AZ03 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | GT370_RS18545 | Protein ID | WP_039885796.1 |
Coordinates | 3354286..3354804 (+) | Length | 173 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | - |
Locus tag | GT370_RS18540 | Protein ID | WP_270183533.1 |
Coordinates | 3354077..3354244 (+) | Length | 56 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GT370_RS18525 (GT370_18500) | 3350185..3351789 | - | 1605 | WP_270183530.1 | hypothetical protein | - |
GT370_RS18530 (GT370_18505) | 3353015..3353629 | - | 615 | WP_270183531.1 | hypothetical protein | - |
GT370_RS18535 (GT370_18510) | 3353626..3353805 | - | 180 | WP_270183532.1 | hypothetical protein | - |
GT370_RS18540 (GT370_18515) | 3354077..3354244 | + | 168 | WP_270183533.1 | DUF1778 domain-containing protein | Antitoxin |
GT370_RS18545 (GT370_18520) | 3354286..3354804 | + | 519 | WP_039885796.1 | GNAT family N-acetyltransferase | Toxin |
GT370_RS18550 (GT370_18525) | 3354860..3355564 | - | 705 | WP_270183534.1 | hypothetical protein | - |
GT370_RS18555 (GT370_18530) | 3355552..3355965 | - | 414 | WP_270183517.1 | hypothetical protein | - |
GT370_RS18560 (GT370_18535) | 3356085..3356489 | - | 405 | WP_270183518.1 | hypothetical protein | - |
GT370_RS18565 (GT370_18540) | 3356642..3356899 | - | 258 | WP_270183519.1 | hypothetical protein | - |
GT370_RS18570 (GT370_18545) | 3357393..3358226 | + | 834 | WP_008495269.1 | IclR family transcriptional regulator | - |
GT370_RS18575 (GT370_18550) | 3358508..3359772 | + | 1265 | Protein_3649 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3330157..3365572 | 35415 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 173 a.a. Molecular weight: 19049.16 Da Isoelectric Point: 9.8224
>T264200 WP_039885796.1 NZ_CP110774:3354286-3354804 [Acidocella sp. MX-AZ03]
VRRRLLPPERLTAAHDVSGFQNGRHPSLDEWLRDRALVSEGLSARTYVVRAGEPPHLVVGYYAITTAMEQRLSLPSAKLR
RGMPEQIPLMLIGRLAVDQRYHGIGLGTDLLADALKRCLAVSEVAGVRAVVTHAIDETAMAFYRRHGFLASPLGEKVLMM
PIETIRAVFADQ
VRRRLLPPERLTAAHDVSGFQNGRHPSLDEWLRDRALVSEGLSARTYVVRAGEPPHLVVGYYAITTAMEQRLSLPSAKLR
RGMPEQIPLMLIGRLAVDQRYHGIGLGTDLLADALKRCLAVSEVAGVRAVVTHAIDETAMAFYRRHGFLASPLGEKVLMM
PIETIRAVFADQ
Download Length: 519 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|