Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1888523..1889148 | Replicon | chromosome |
Accession | NZ_CP110774 | ||
Organism | Acidocella sp. MX-AZ03 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | GT370_RS10520 | Protein ID | WP_008494675.1 |
Coordinates | 1888523..1888924 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | GT370_RS10525 | Protein ID | WP_039885345.1 |
Coordinates | 1888924..1889148 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GT370_RS10500 (GT370_10480) | 1884229..1885017 | + | 789 | WP_083878705.1 | class I SAM-dependent methyltransferase | - |
GT370_RS10505 (GT370_10485) | 1885353..1885718 | + | 366 | WP_144052762.1 | hypothetical protein | - |
GT370_RS10510 (GT370_10490) | 1886027..1886677 | + | 651 | WP_270183042.1 | DUF4113 domain-containing protein | - |
GT370_RS10515 (GT370_10495) | 1886820..1888166 | - | 1347 | WP_008494677.1 | site-specific integrase | - |
GT370_RS10520 (GT370_10500) | 1888523..1888924 | - | 402 | WP_008494675.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
GT370_RS10525 (GT370_10505) | 1888924..1889148 | - | 225 | WP_039885345.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
GT370_RS10530 (GT370_10510) | 1889228..1890673 | - | 1446 | WP_008494673.1 | hypothetical protein | - |
GT370_RS10535 (GT370_10515) | 1890834..1891610 | + | 777 | WP_270183043.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14951.23 Da Isoelectric Point: 7.7774
>T264199 WP_008494675.1 NZ_CP110774:c1888924-1888523 [Acidocella sp. MX-AZ03]
MLRYMLDTNLCIRVLRDRPQGVRARFNANAEALCLSDVVLYELLYGAERSNDPPRIRREVEHFAGRLTVLPFDSEAAAHT
AEICGDLKRRGNVIGPYDLMIAGHARSKGLIIVTGNLGEFQRVLGVRSEDWLV
MLRYMLDTNLCIRVLRDRPQGVRARFNANAEALCLSDVVLYELLYGAERSNDPPRIRREVEHFAGRLTVLPFDSEAAAHT
AEICGDLKRRGNVIGPYDLMIAGHARSKGLIIVTGNLGEFQRVLGVRSEDWLV
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|