Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacT-ataR/DUF1778(antitoxin) |
| Location | 1787472..1788325 | Replicon | chromosome |
| Accession | NZ_CP110774 | ||
| Organism | Acidocella sp. MX-AZ03 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | GT370_RS10015 | Protein ID | WP_039885796.1 |
| Coordinates | 1787472..1787990 (-) | Length | 173 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | K5YGS5 |
| Locus tag | GT370_RS10020 | Protein ID | WP_008495825.1 |
| Coordinates | 1788032..1788325 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GT370_RS09985 (GT370_09965) | 1782484..1783533 | + | 1050 | WP_039885813.1 | IS5 family transposase | - |
| GT370_RS09990 (GT370_09970) | 1783860..1784225 | - | 366 | WP_008495839.1 | IS5/IS1182 family transposase | - |
| GT370_RS09995 (GT370_09975) | 1784314..1784751 | - | 438 | WP_008495838.1 | autoinducer binding domain-containing protein | - |
| GT370_RS10000 (GT370_09980) | 1785179..1785436 | + | 258 | WP_270183519.1 | hypothetical protein | - |
| GT370_RS10005 (GT370_09985) | 1785786..1786724 | + | 939 | WP_039885801.1 | hypothetical protein | - |
| GT370_RS10010 (GT370_09990) | 1786712..1787416 | + | 705 | WP_270183534.1 | hypothetical protein | - |
| GT370_RS10015 (GT370_09995) | 1787472..1787990 | - | 519 | WP_039885796.1 | GNAT family N-acetyltransferase | Toxin |
| GT370_RS10020 (GT370_10000) | 1788032..1788325 | - | 294 | WP_008495825.1 | DUF1778 domain-containing protein | Antitoxin |
| GT370_RS10025 (GT370_10005) | 1788473..1789264 | + | 792 | WP_008495824.1 | hypothetical protein | - |
| GT370_RS10030 (GT370_10010) | 1789433..1789876 | + | 444 | WP_008495634.1 | carboxymuconolactone decarboxylase family protein | - |
| GT370_RS10035 (GT370_10015) | 1789880..1790758 | + | 879 | WP_008495635.1 | RNA polymerase sigma factor SigJ | - |
| GT370_RS10040 (GT370_10020) | 1791046..1791369 | + | 324 | WP_270184311.1 | GNAT family N-acetyltransferase | - |
| GT370_RS10045 (GT370_10025) | 1791597..1792510 | - | 914 | Protein_1972 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 173 a.a. Molecular weight: 19049.16 Da Isoelectric Point: 9.8224
>T264198 WP_039885796.1 NZ_CP110774:c1787990-1787472 [Acidocella sp. MX-AZ03]
VRRRLLPPERLTAAHDVSGFQNGRHPSLDEWLRDRALVSEGLSARTYVVRAGEPPHLVVGYYAITTAMEQRLSLPSAKLR
RGMPEQIPLMLIGRLAVDQRYHGIGLGTDLLADALKRCLAVSEVAGVRAVVTHAIDETAMAFYRRHGFLASPLGEKVLMM
PIETIRAVFADQ
VRRRLLPPERLTAAHDVSGFQNGRHPSLDEWLRDRALVSEGLSARTYVVRAGEPPHLVVGYYAITTAMEQRLSLPSAKLR
RGMPEQIPLMLIGRLAVDQRYHGIGLGTDLLADALKRCLAVSEVAGVRAVVTHAIDETAMAFYRRHGFLASPLGEKVLMM
PIETIRAVFADQ
Download Length: 519 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|