Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 70751..71376 | Replicon | chromosome |
Accession | NZ_CP110774 | ||
Organism | Acidocella sp. MX-AZ03 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | GT370_RS00410 | Protein ID | WP_008495786.1 |
Coordinates | 70975..71376 (+) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | GT370_RS00405 | Protein ID | WP_039885769.1 |
Coordinates | 70751..70975 (+) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GT370_RS00375 (GT370_00375) | 66532..66675 | - | 144 | WP_270183708.1 | hypothetical protein | - |
GT370_RS00385 (GT370_00385) | 67956..68285 | + | 330 | WP_270183709.1 | Gfo/Idh/MocA family oxidoreductase | - |
GT370_RS00390 (GT370_00390) | 68282..68803 | + | 522 | WP_270183710.1 | Gfo/Idh/MocA family oxidoreductase | - |
GT370_RS00395 (GT370_00395) | 69227..69781 | + | 555 | WP_270183711.1 | hypothetical protein | - |
GT370_RS00400 (GT370_00400) | 69790..70671 | + | 882 | WP_270183712.1 | hypothetical protein | - |
GT370_RS00405 (GT370_00405) | 70751..70975 | + | 225 | WP_039885769.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
GT370_RS00410 (GT370_00410) | 70975..71376 | + | 402 | WP_008495786.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
GT370_RS00415 (GT370_00415) | 71573..72265 | - | 693 | WP_270183713.1 | zinc ribbon domain-containing protein | - |
GT370_RS00420 (GT370_00420) | 72796..73874 | - | 1079 | Protein_77 | IS5 family transposase | - |
GT370_RS00425 (GT370_00425) | 74007..74324 | - | 318 | WP_270183714.1 | hypothetical protein | - |
GT370_RS00430 (GT370_00430) | 74558..75297 | + | 740 | Protein_79 | IS5 family transposase | - |
GT370_RS00435 (GT370_00435) | 75319..75762 | - | 444 | WP_008495829.1 | hypothetical protein | - |
GT370_RS00440 (GT370_00440) | 75785..75913 | - | 129 | WP_270183715.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15122.28 Da Isoelectric Point: 5.6986
>T264196 WP_008495786.1 NZ_CP110774:70975-71376 [Acidocella sp. MX-AZ03]
MLRYMLDTNLCIRVLRDRPQEVRTRFNANAEALCLSDVVLYELLYGAERSNDPPRIRREVEHFAGRLTVLPFDSEAAAHT
AEIRGDLERLGNVIGPYDLMIAGHARSRGLIVVTGNLGEFQRVLGLRSEDWLE
MLRYMLDTNLCIRVLRDRPQEVRTRFNANAEALCLSDVVLYELLYGAERSNDPPRIRREVEHFAGRLTVLPFDSEAAAHT
AEIRGDLERLGNVIGPYDLMIAGHARSRGLIVVTGNLGEFQRVLGLRSEDWLE
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|