Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-Phd |
Location | 37595..38272 | Replicon | chromosome |
Accession | NZ_CP110774 | ||
Organism | Acidocella sp. MX-AZ03 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | K5YSX0 |
Locus tag | GT370_RS00200 | Protein ID | WP_008495710.1 |
Coordinates | 37595..38026 (-) | Length | 144 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | K5YTJ1 |
Locus tag | GT370_RS00205 | Protein ID | WP_008495709.1 |
Coordinates | 38030..38272 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
GT370_RS00185 (GT370_00185) | 33190..34239 | - | 1050 | WP_039885813.1 | IS5 family transposase | - |
GT370_RS00190 (GT370_00190) | 34309..35991 | - | 1683 | WP_270183699.1 | tetratricopeptide repeat protein | - |
GT370_RS00195 (GT370_00195) | 36107..37156 | + | 1050 | WP_039885813.1 | IS5 family transposase | - |
GT370_RS00200 (GT370_00200) | 37595..38026 | - | 432 | WP_008495710.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
GT370_RS00205 (GT370_00205) | 38030..38272 | - | 243 | WP_008495709.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
GT370_RS00210 (GT370_00210) | 38368..39030 | - | 663 | WP_008495708.1 | hypothetical protein | - |
GT370_RS00215 (GT370_00215) | 39018..39905 | - | 888 | WP_008495707.1 | hypothetical protein | - |
GT370_RS00220 (GT370_00220) | 39940..40452 | - | 513 | WP_270183700.1 | hypothetical protein | - |
GT370_RS00225 (GT370_00225) | 40739..41428 | + | 690 | WP_008495706.1 | hypothetical protein | - |
GT370_RS00230 (GT370_00230) | 41476..42700 | + | 1225 | Protein_39 | IS3 family transposase | - |
GT370_RS00235 (GT370_00235) | 42737..42928 | - | 192 | WP_144052869.1 | hypothetical protein | - |
GT370_RS00240 (GT370_00240) | 42976..43272 | + | 297 | WP_008495702.1 | DUF1778 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15468.80 Da Isoelectric Point: 7.1292
>T264195 WP_008495710.1 NZ_CP110774:c38026-37595 [Acidocella sp. MX-AZ03]
MYLVDTNVISARAPSRVPLPDLAAWMDAHSADLFLSTVTIAEIEDGIAKAKREGATRKARDLTAWLETVLHLYAARILPF
DVASARLAGSLSDCARGQGHAPGFADIIIAATAQHHGLTILTRNLRHFEPLGVAVHDPFIRLP
MYLVDTNVISARAPSRVPLPDLAAWMDAHSADLFLSTVTIAEIEDGIAKAKREGATRKARDLTAWLETVLHLYAARILPF
DVASARLAGSLSDCARGQGHAPGFADIIIAATAQHHGLTILTRNLRHFEPLGVAVHDPFIRLP
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|