Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 213919..214592 | Replicon | chromosome |
Accession | NZ_CP110680 | ||
Organism | Cellulomonas fimi strain Clb-11 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OOT42_RS00980 | Protein ID | WP_273653110.1 |
Coordinates | 213919..214353 (-) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OOT42_RS00985 | Protein ID | WP_273653111.1 |
Coordinates | 214350..214592 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOT42_RS00950 | 209046..210551 | + | 1506 | WP_273653104.1 | amino acid permease | - |
OOT42_RS00955 | 210619..211356 | + | 738 | WP_273653105.1 | MIP/aquaporin family protein | - |
OOT42_RS00960 | 211417..211857 | - | 441 | WP_273653106.1 | nitroreductase family deazaflavin-dependent oxidoreductase | - |
OOT42_RS00965 | 211933..212121 | - | 189 | WP_273653107.1 | antitoxin | - |
OOT42_RS00970 | 212286..212465 | + | 180 | WP_273653108.1 | DUF1918 domain-containing protein | - |
OOT42_RS00975 | 212506..213840 | + | 1335 | WP_273653109.1 | alpha/beta fold hydrolase | - |
OOT42_RS00980 | 213919..214353 | - | 435 | WP_273653110.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OOT42_RS00985 | 214350..214592 | - | 243 | WP_273653111.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
OOT42_RS00990 | 214731..216266 | - | 1536 | WP_273653112.1 | HEAT repeat domain-containing protein | - |
OOT42_RS00995 | 216317..217243 | - | 927 | WP_273654753.1 | 1,4-beta-xylanase | - |
OOT42_RS01000 | 217353..217781 | - | 429 | WP_273653113.1 | VOC family protein | - |
OOT42_RS01005 | 217839..218615 | - | 777 | WP_273654754.1 | uracil-DNA glycosylase | - |
OOT42_RS01010 | 218684..219223 | - | 540 | WP_273653114.1 | TIGR00725 family protein | - |
OOT42_RS01015 | 219368..219586 | + | 219 | WP_273653115.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15522.66 Da Isoelectric Point: 6.8442
>T264194 WP_273653110.1 NZ_CP110680:c214353-213919 [Cellulomonas fimi]
VILPDVNVLVGAARADAPQHARLRTWVEQHVPGPETFGLTDAVLGGVVRVLTHPRVFVRPSTLDEALGFVDALVAHPNVS
RVTPGPRHWQLVAELCRAADARGNLVADAQHAAVAIEHGATWVSQDRDFARFPGLRWVTAVEPG
VILPDVNVLVGAARADAPQHARLRTWVEQHVPGPETFGLTDAVLGGVVRVLTHPRVFVRPSTLDEALGFVDALVAHPNVS
RVTPGPRHWQLVAELCRAADARGNLVADAQHAAVAIEHGATWVSQDRDFARFPGLRWVTAVEPG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|