Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 2892089..2892732 | Replicon | chromosome |
Accession | NZ_CP110678 | ||
Organism | Sphingomonas sp. S1-29 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OKW76_RS13755 | Protein ID | WP_265549422.1 |
Coordinates | 2892089..2892481 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OKW76_RS13760 | Protein ID | WP_265549423.1 |
Coordinates | 2892478..2892732 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OKW76_RS13750 (OKW76_13750) | 2887567..2892087 | + | 4521 | WP_265552984.1 | glutamate synthase large subunit | - |
OKW76_RS13755 (OKW76_13755) | 2892089..2892481 | - | 393 | WP_265549422.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OKW76_RS13760 (OKW76_13760) | 2892478..2892732 | - | 255 | WP_265549423.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OKW76_RS13765 (OKW76_13765) | 2892829..2893503 | + | 675 | WP_265549424.1 | glutathione S-transferase family protein | - |
OKW76_RS13770 (OKW76_13770) | 2893518..2894144 | + | 627 | WP_265549425.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
OKW76_RS13775 (OKW76_13775) | 2894154..2895005 | - | 852 | WP_265549426.1 | SDR family oxidoreductase | - |
OKW76_RS13780 (OKW76_13780) | 2895416..2896465 | - | 1050 | WP_265549427.1 | GGDEF domain-containing protein | - |
OKW76_RS13785 (OKW76_13785) | 2896589..2897125 | - | 537 | WP_265549428.1 | redoxin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 13957.28 Da Isoelectric Point: 6.0719
>T264191 WP_265549422.1 NZ_CP110678:c2892481-2892089 [Sphingomonas sp. S1-29]
VIAIDTSAILAIVLREPEAETFGALIQAHRRVFIGAPTLFELRMVTLGKFPEPVRAAVDALALAAPIETIAFTAEHHLVA
LDAFDRYGKGRHPASLNMGDCLSYAIAKIADCPLLFKGNDFGLTDIARVA
VIAIDTSAILAIVLREPEAETFGALIQAHRRVFIGAPTLFELRMVTLGKFPEPVRAAVDALALAAPIETIAFTAEHHLVA
LDAFDRYGKGRHPASLNMGDCLSYAIAKIADCPLLFKGNDFGLTDIARVA
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|