264188

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pasABC/RelE-HTH
Location 2167956..2168424 Replicon chromosome
Accession NZ_CP110678
Organism Sphingomonas sp. S1-29

Toxin (Protein)


Gene name pasB Uniprot ID -
Locus tag OKW76_RS10285 Protein ID WP_265548809.1
Coordinates 2168158..2168424 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name pasA Uniprot ID -
Locus tag OKW76_RS10280 Protein ID WP_256505633.1
Coordinates 2167956..2168174 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OKW76_RS10235 (OKW76_10235) 2163858..2164583 + 726 WP_265548801.1 bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG -
OKW76_RS10240 (OKW76_10240) 2164584..2164955 - 372 WP_265548802.1 tRNA-binding protein -
OKW76_RS10245 (OKW76_10245) 2165004..2165588 + 585 WP_265548803.1 hypothetical protein -
OKW76_RS10250 (OKW76_10250) 2165591..2165875 + 285 WP_256508112.1 DUF427 domain-containing protein -
OKW76_RS10255 (OKW76_10255) 2165872..2166171 + 300 WP_265548804.1 alkylphosphonate utilization protein -
OKW76_RS10260 (OKW76_10260) 2166237..2166362 + 126 WP_265548805.1 hypothetical protein -
OKW76_RS10265 (OKW76_10265) 2166410..2166616 - 207 WP_265548806.1 hypothetical protein -
OKW76_RS10270 (OKW76_10270) 2166673..2167221 + 549 WP_265548807.1 hypothetical protein -
OKW76_RS10275 (OKW76_10275) 2167471..2167899 + 429 WP_265548808.1 cupin domain-containing protein -
OKW76_RS10280 (OKW76_10280) 2167956..2168174 + 219 WP_256505633.1 TraY domain-containing protein Antitoxin
OKW76_RS10285 (OKW76_10285) 2168158..2168424 + 267 WP_265548809.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OKW76_RS10290 (OKW76_10290) 2168497..2168769 + 273 WP_265548810.1 type II toxin-antitoxin system prevent-host-death family antitoxin -
OKW76_RS10295 (OKW76_10295) 2168766..2169032 + 267 WP_265548811.1 Txe/YoeB family addiction module toxin -
OKW76_RS10300 (OKW76_10300) 2169108..2170037 + 930 WP_265548812.1 5'-nucleotidase -
OKW76_RS10305 (OKW76_10305) 2170184..2172124 - 1941 WP_265548813.1 phosphomethylpyrimidine synthase ThiC -
OKW76_RS10310 (OKW76_10310) 2172277..2172621 - 345 WP_265548814.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Relaxosome protein TraY

(4-47)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10242.84 Da        Isoelectric Point: 10.4120

>T264188 WP_265548809.1 NZ_CP110678:2168158-2168424 [Sphingomonas sp. S1-29]
MAWRIEFLPEAAKELAKLDRTAAARIIKTLETRIAVQDDPRSLGSALTGDHAGYWRWRIGDYRVVARIEDDRVLILVVRV
AHRREVYR

Download         Length: 267 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8108.13 Da        Isoelectric Point: 4.3525

>AT264188 WP_256505633.1 NZ_CP110678:2167956-2168174 [Sphingomonas sp. S1-29]
MLAVRLDTETEARLEALAARTGRTKTFYAREAIVAHLDDLEDFYLAEERLRDFRDGDAIPLADLKAQLGLAD

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References