Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3702976..3703601 | Replicon | chromosome |
Accession | NZ_CP110674 | ||
Organism | Mycobacterium tuberculosis strain BLR-31d |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQA0 |
Locus tag | OO115_RS17490 | Protein ID | WP_003403218.1 |
Coordinates | 3702976..3703377 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ36 |
Locus tag | OO115_RS17495 | Protein ID | WP_003403213.1 |
Coordinates | 3703374..3703601 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO115_RS17465 (OO115_17465) | 3698066..3699013 | - | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
OO115_RS17470 (OO115_17470) | 3699117..3700181 | - | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
OO115_RS17475 (OO115_17475) | 3700576..3701667 | - | 1092 | WP_003900977.1 | galactokinase | - |
OO115_RS17480 (OO115_17480) | 3701664..3702745 | - | 1082 | Protein_3452 | galactose-1-phosphate uridylyltransferase | - |
OO115_RS17485 (OO115_17485) | 3702764..3702847 | - | 84 | Protein_3453 | galactose-1-phosphate uridylyltransferase | - |
OO115_RS17490 (OO115_17490) | 3702976..3703377 | - | 402 | WP_003403218.1 | type II toxin-antitoxin system ribonuclease VapC29 | Toxin |
OO115_RS17495 (OO115_17495) | 3703374..3703601 | - | 228 | WP_003403213.1 | antitoxin VapB29 | Antitoxin |
OO115_RS17500 (OO115_17500) | 3703796..3704038 | - | 243 | WP_003403210.1 | hypothetical protein | - |
OO115_RS17505 (OO115_17505) | 3704035..3704784 | - | 750 | WP_003898528.1 | hypothetical protein | - |
OO115_RS17510 (OO115_17510) | 3704868..3707435 | + | 2568 | WP_003901879.1 | SEC-C metal-binding domain-containing protein | - |
OO115_RS17515 (OO115_17515) | 3707454..3708059 | - | 606 | WP_003898526.1 | hypothetical protein | - |
OO115_RS17520 (OO115_17520) | 3708201..3708422 | + | 222 | WP_003898525.1 | DUF4926 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 13937.76 Da Isoelectric Point: 5.7441
>T264184 WP_003403218.1 NZ_CP110674:c3703377-3702976 [Mycobacterium tuberculosis]
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
VTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALS
FAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQA0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSC9 |