Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 3697324..3697973 | Replicon | chromosome |
Accession | NZ_CP110674 | ||
Organism | Mycobacterium tuberculosis strain BLR-31d |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P67241 |
Locus tag | OO115_RS17455 | Protein ID | WP_003403236.1 |
Coordinates | 3697324..3697719 (-) | Length | 132 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ34 |
Locus tag | OO115_RS17460 | Protein ID | WP_003403235.1 |
Coordinates | 3697719..3697973 (-) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO115_RS17430 (OO115_17430) | 3692651..3694378 | + | 1728 | WP_003901883.1 | exodeoxyribonuclease V subunit alpha | - |
OO115_RS17435 (OO115_17435) | 3694471..3695622 | + | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
OO115_RS17440 (OO115_17440) | 3695694..3696101 | - | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | - |
OO115_RS17445 (OO115_17445) | 3696098..3696358 | - | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
OO115_RS17450 (OO115_17450) | 3696490..3697230 | + | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
OO115_RS17455 (OO115_17455) | 3697324..3697719 | - | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | Toxin |
OO115_RS17460 (OO115_17460) | 3697719..3697973 | - | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | Antitoxin |
OO115_RS17465 (OO115_17465) | 3698066..3699013 | - | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
OO115_RS17470 (OO115_17470) | 3699117..3700181 | - | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
OO115_RS17475 (OO115_17475) | 3700576..3701667 | - | 1092 | WP_003900977.1 | galactokinase | - |
OO115_RS17480 (OO115_17480) | 3701664..3702745 | - | 1082 | Protein_3452 | galactose-1-phosphate uridylyltransferase | - |
OO115_RS17485 (OO115_17485) | 3702764..3702847 | - | 84 | Protein_3453 | galactose-1-phosphate uridylyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14250.04 Da Isoelectric Point: 4.7475
>T264183 WP_003403236.1 NZ_CP110674:c3697719-3697324 [Mycobacterium tuberculosis]
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
MVIDTSALVAMLSDEPDAERFEAAVEADHIRLMSTASYLETALVIEARFGEPGGRELDLWLHRAAVDLVAVHADQADAAR
AAYRTYGKGRHRAGLNYGDCFSYGLAKISGQPLLFKGEDFQHTDIATVALP
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4XGR | |
PDB | 4XGQ |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSC2 |