Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
| Location | 3695694..3696358 | Replicon | chromosome |
| Accession | NZ_CP110674 | ||
| Organism | Mycobacterium tuberculosis strain BLR-31d | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P96917 |
| Locus tag | OO115_RS17440 | Protein ID | WP_003403246.1 |
| Coordinates | 3695694..3696101 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WF18 |
| Locus tag | OO115_RS17445 | Protein ID | WP_003403244.1 |
| Coordinates | 3696098..3696358 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO115_RS17430 (OO115_17430) | 3692651..3694378 | + | 1728 | WP_003901883.1 | exodeoxyribonuclease V subunit alpha | - |
| OO115_RS17435 (OO115_17435) | 3694471..3695622 | + | 1152 | WP_003403248.1 | FIST N-terminal domain-containing protein | - |
| OO115_RS17440 (OO115_17440) | 3695694..3696101 | - | 408 | WP_003403246.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OO115_RS17445 (OO115_17445) | 3696098..3696358 | - | 261 | WP_003403244.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OO115_RS17450 (OO115_17450) | 3696490..3697230 | + | 741 | WP_003403239.1 | TVP38/TMEM64 family protein | - |
| OO115_RS17455 (OO115_17455) | 3697324..3697719 | - | 396 | WP_003403236.1 | type II toxin-antitoxin system toxin ribonuclease C30 | - |
| OO115_RS17460 (OO115_17460) | 3697719..3697973 | - | 255 | WP_003403235.1 | type II toxin-antitoxin system antitoxin VapB30 | - |
| OO115_RS17465 (OO115_17465) | 3698066..3699013 | - | 948 | WP_003403232.1 | DUF732 domain-containing protein | - |
| OO115_RS17470 (OO115_17470) | 3699117..3700181 | - | 1065 | WP_003898532.1 | zinc ribbon domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14376.37 Da Isoelectric Point: 4.3568
>T264182 WP_003403246.1 NZ_CP110674:c3696101-3695694 [Mycobacterium tuberculosis]
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
VSTTPAAGVLDTSVFIATESGRQLDEALIPDRVATTVVTLAELRVGVLAAATTDIRAQRLATLESVADMETLPVDDDAAR
MWARLRIHLAESGRRVRINDLWIAAVAASRALPVITQDDDFAALDGAASVEIIRV
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3DBO |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3DBO | |
| AlphaFold DB | A0A7U4BSE4 |