264181

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 3660233..3660866 Replicon chromosome
Accession NZ_CP110674
Organism Mycobacterium tuberculosis strain BLR-31d

Toxin (Protein)


Gene name vapC Uniprot ID G0TQD6
Locus tag OO115_RS17270 Protein ID WP_003403365.1
Coordinates 3660483..3660866 (+) Length 128 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID P9WJ56
Locus tag OO115_RS17265 Protein ID WP_003403368.1
Coordinates 3660233..3660388 (+) Length 52 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO115_RS17235 (OO115_17235) 3655350..3657713 - 2364 WP_003901895.1 arylsulfatase AtsD -
OO115_RS17240 (OO115_17240) 3657827..3658081 + 255 WP_003911263.1 antitoxin VapB7 -
OO115_RS17245 (OO115_17245) 3658078..3658515 + 438 WP_003403386.1 type II toxin-antitoxin system VapC family toxin -
OO115_RS17250 (OO115_17250) 3658625..3658870 + 246 WP_003403381.1 ribbon-helix-helix protein, CopG family -
OO115_RS17255 (OO115_17255) 3658857..3659165 + 309 WP_003403376.1 type II toxin-antitoxin system PemK/MazF family toxin -
OO115_RS17260 (OO115_17260) 3659441..3660157 + 717 WP_003403371.1 CPBP family intramembrane metalloprotease -
OO115_RS17265 (OO115_17265) 3660233..3660388 + 156 WP_003403368.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OO115_RS17270 (OO115_17270) 3660483..3660866 + 384 WP_003403365.1 ribonuclease VapC6 Toxin
OO115_RS17275 (OO115_17275) 3661254..3662264 - 1011 WP_003911248.1 ABC transporter ATP-binding protein -
OO115_RS17280 (OO115_17280) 3662345..3663850 - 1506 WP_003403360.1 carotenoid cleavage oxygenase -
OO115_RS17285 (OO115_17285) 3663921..3664616 + 696 WP_003403355.1 TetR/AcrR family transcriptional regulator -
OO115_RS17290 (OO115_17290) 3664609..3665001 - 393 WP_003403353.1 50S ribosomal protein L7/L12 -
OO115_RS17295 (OO115_17295) 3665038..3665574 - 537 WP_003403341.1 50S ribosomal protein L10 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(3-44)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 13959.73 Da        Isoelectric Point: 6.0803

>T264181 WP_003403365.1 NZ_CP110674:3660483-3660866 [Mycobacterium tuberculosis]
MAAATTTGTHRGLELRAAQRAVGSCEPQRAEFCRSARNADEFDQMSRMFGDVYPDVPVPKSVWRWIDSAQHRLARAGAVG
ALSVVDLLICDTAAARGLVVLHDDADYELAERHLPDIRVRRVVSADD

Download         Length: 384 bp

Antitoxin


Download         Length: 52 a.a.        Molecular weight: 5872.72 Da        Isoelectric Point: 5.7734

>AT264181 WP_003403368.1 NZ_CP110674:3660233-3660388 [Mycobacterium tuberculosis]
VSVTQIDLDDEALADVMRIAAVHTKKEAVNLAMRDYVERFRRIEALARSRE

Download         Length: 156 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TQD6

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4BSF8

References