Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 3657827..3658515 | Replicon | chromosome |
Accession | NZ_CP110674 | ||
Organism | Mycobacterium tuberculosis strain BLR-31d |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WFB2 |
Locus tag | OO115_RS17245 | Protein ID | WP_003403386.1 |
Coordinates | 3658078..3658515 (+) | Length | 146 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | O06777 |
Locus tag | OO115_RS17240 | Protein ID | WP_003911263.1 |
Coordinates | 3657827..3658081 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO115_RS17220 (OO115_17220) | 3654541..3654714 | - | 174 | WP_003898549.1 | hypothetical protein | - |
OO115_RS17225 (OO115_17225) | 3654711..3655049 | - | 339 | WP_003403405.1 | PIN domain-containing protein | - |
OO115_RS17230 (OO115_17230) | 3654961..3655287 | - | 327 | WP_003403401.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
OO115_RS17235 (OO115_17235) | 3655350..3657713 | - | 2364 | WP_003901895.1 | arylsulfatase AtsD | - |
OO115_RS17240 (OO115_17240) | 3657827..3658081 | + | 255 | WP_003911263.1 | antitoxin VapB7 | Antitoxin |
OO115_RS17245 (OO115_17245) | 3658078..3658515 | + | 438 | WP_003403386.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OO115_RS17250 (OO115_17250) | 3658625..3658870 | + | 246 | WP_003403381.1 | ribbon-helix-helix protein, CopG family | - |
OO115_RS17255 (OO115_17255) | 3658857..3659165 | + | 309 | WP_003403376.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
OO115_RS17260 (OO115_17260) | 3659441..3660157 | + | 717 | WP_003403371.1 | CPBP family intramembrane metalloprotease | - |
OO115_RS17265 (OO115_17265) | 3660233..3660388 | + | 156 | WP_003403368.1 | type II toxin-antitoxin system VapB family antitoxin | - |
OO115_RS17270 (OO115_17270) | 3660483..3660866 | + | 384 | WP_003403365.1 | ribonuclease VapC6 | - |
OO115_RS17275 (OO115_17275) | 3661254..3662264 | - | 1011 | WP_003911248.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 146 a.a. Molecular weight: 15245.39 Da Isoelectric Point: 5.1865
>T264178 WP_003403386.1 NZ_CP110674:3658078-3658515 [Mycobacterium tuberculosis]
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
MIVLDTTVLVYAKGAEHPLRDPCRDLVAAIADERIAATTTAEVIQEFVHVRARRRDRSDAAALGRVTMPNCSRRYSPSIE
ATSKRGLTLFETTPGLEACDAVLAAVAASAGATALVSADPAFADLSDVVHVIPDAAGMVSLLGDR
Download Length: 438 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BSW5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A806JQG1 |