Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 3572213..3572922 | Replicon | chromosome |
| Accession | NZ_CP110674 | ||
| Organism | Mycobacterium tuberculosis strain BLR-31d | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P9WF74 |
| Locus tag | OO115_RS16770 | Protein ID | WP_003403837.1 |
| Coordinates | 3572213..3572641 (-) | Length | 143 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TEX4 |
| Locus tag | OO115_RS16775 | Protein ID | WP_003403834.1 |
| Coordinates | 3572665..3572922 (-) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO115_RS16745 (OO115_16745) | 3567916..3569448 | + | 1533 | WP_003403847.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
| OO115_RS16750 (OO115_16750) | 3569455..3570627 | + | 1173 | WP_003403845.1 | acyl-CoA dehydrogenase family protein | - |
| OO115_RS16755 (OO115_16755) | 3570638..3571522 | + | 885 | WP_003403844.1 | 3-hydroxyisobutyrate dehydrogenase | - |
| OO115_RS16760 (OO115_16760) | 3571591..3571836 | - | 246 | WP_003403841.1 | hypothetical protein | - |
| OO115_RS16765 (OO115_16765) | 3571995..3572132 | + | 138 | WP_003403839.1 | hypothetical protein | - |
| OO115_RS16770 (OO115_16770) | 3572213..3572641 | - | 429 | WP_003403837.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OO115_RS16775 (OO115_16775) | 3572665..3572922 | - | 258 | WP_003403834.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| OO115_RS16780 (OO115_16780) | 3573013..3575286 | - | 2274 | WP_016330384.1 | PE family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15831.27 Da Isoelectric Point: 7.5536
>T264177 WP_003403837.1 NZ_CP110674:c3572641-3572213 [Mycobacterium tuberculosis]
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
MFLLDANVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLATNRRIFEIPSPRAEAFAFVEAVTAQPHHL
PTNPGPRHLMLLRKLCDEADASGDLIPDAVLAAIAVGHHCAVVSLDRDFARFASVRHIRPPL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CDR3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TEX4 |