Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 3398826..3399445 | Replicon | chromosome |
Accession | NZ_CP110674 | ||
Organism | Mycobacterium tuberculosis strain BLR-31d |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | OO115_RS15930 | Protein ID | WP_003404726.1 |
Coordinates | 3398826..3399260 (-) | Length | 145 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | P9WJ06 |
Locus tag | OO115_RS15935 | Protein ID | WP_003898641.1 |
Coordinates | 3399266..3399445 (-) | Length | 60 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO115_RS15905 (OO115_15905) | 3394161..3395399 | + | 1239 | WP_003404744.1 | acetyl-CoA acetyltransferase | - |
OO115_RS15910 (OO115_15910) | 3395401..3396909 | + | 1509 | WP_003404742.1 | carotenoid oxygenase family protein | - |
OO115_RS15915 (OO115_15915) | 3397076..3397306 | + | 231 | WP_003898642.1 | hypothetical protein | - |
OO115_RS15920 (OO115_15920) | 3397441..3397890 | - | 450 | WP_003404738.1 | hypothetical protein | - |
OO115_RS15925 (OO115_15925) | 3397955..3398728 | - | 774 | WP_003404735.1 | VOC family protein | - |
OO115_RS15930 (OO115_15930) | 3398826..3399260 | - | 435 | WP_003404726.1 | SRPBCC family protein | Toxin |
OO115_RS15935 (OO115_15935) | 3399266..3399445 | - | 180 | WP_003898641.1 | antitoxin | Antitoxin |
OO115_RS15940 (OO115_15940) | 3399571..3399729 | - | 159 | WP_003404720.1 | hypothetical protein | - |
OO115_RS15945 (OO115_15945) | 3400002..3402395 | - | 2394 | WP_003898639.1 | cation-translocating P-type ATPase | - |
OO115_RS15950 (OO115_15950) | 3402392..3403972 | - | 1581 | WP_003910977.1 | serine hydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15754.47 Da Isoelectric Point: 9.7977
>T264176 WP_003404726.1 NZ_CP110674:c3399260-3398826 [Mycobacterium tuberculosis]
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
MAKLSGSIDVPLPPEEAWMHASDLTRYREWLTIHKVWRSKLPEVLEKGTVVESYVEVKGMPNRIKWTIVRYKPPEGMTLN
GDGVGGVKVKLIAKVAPKEHGSVVSFDVHLGGPALLGPIGMIVAAALRADIRESLQNFVTVFAG
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|