Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 3182665..3183296 | Replicon | chromosome |
| Accession | NZ_CP110674 | ||
| Organism | Mycobacterium tuberculosis strain BLR-31d | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A7U4F9D0 |
| Locus tag | OO115_RS14875 | Protein ID | WP_003405820.1 |
| Coordinates | 3182985..3183296 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G0TGZ7 |
| Locus tag | OO115_RS14870 | Protein ID | WP_003405836.1 |
| Coordinates | 3182665..3182985 (+) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO115_RS14845 (OO115_14845) | 3177861..3178499 | + | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
| OO115_RS14850 (OO115_14850) | 3178496..3179743 | + | 1248 | WP_003405846.1 | exodeoxyribonuclease VII large subunit | - |
| OO115_RS14855 (OO115_14855) | 3179733..3179990 | + | 258 | WP_003405844.1 | exodeoxyribonuclease VII small subunit | - |
| OO115_RS14860 (OO115_14860) | 3180000..3181112 | + | 1113 | WP_003405840.1 | 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase | - |
| OO115_RS14865 (OO115_14865) | 3181119..3182655 | - | 1537 | Protein_2941 | carboxylesterase/lipase family protein | - |
| OO115_RS14870 (OO115_14870) | 3182665..3182985 | + | 321 | WP_003405836.1 | type II toxin-antitoxin system antitoxin MazE3 | Antitoxin |
| OO115_RS14875 (OO115_14875) | 3182985..3183296 | + | 312 | WP_003405820.1 | type II toxin-antitoxin system toxin endoribonuclease MazF3 | Toxin |
| OO115_RS14880 (OO115_14880) | 3183408..3184565 | + | 1158 | WP_003898727.1 | AI-2E family transporter | - |
| OO115_RS14885 (OO115_14885) | 3184572..3185216 | - | 645 | WP_003915494.1 | DUF4245 domain-containing protein | - |
| OO115_RS14890 (OO115_14890) | 3185272..3186360 | + | 1089 | WP_003898726.1 | class II fructose-bisphosphatase | - |
| OO115_RS14895 (OO115_14895) | 3186391..3187815 | + | 1425 | WP_003405805.1 | class II fumarate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11061.82 Da Isoelectric Point: 4.9371
>T264174 WP_003405820.1 NZ_CP110674:3182985-3183296 [Mycobacterium tuberculosis]
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
MRPIHIAQLDKARPVLILTREVVRPHLTNVTVAPITTTVRGLATEVPVDAVNGLNQPSVVSCDNIQTIPVCDLGRQIGYL
LASQEPALAEAIGNAFDLDWVVA
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4F9D0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TGZ7 |