Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 3173972..3174540 | Replicon | chromosome |
| Accession | NZ_CP110674 | ||
| Organism | Mycobacterium tuberculosis strain BLR-31d | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TH08 |
| Locus tag | OO115_RS14820 | Protein ID | WP_003405865.1 |
| Coordinates | 3173972..3174346 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TH07 |
| Locus tag | OO115_RS14825 | Protein ID | WP_003405863.1 |
| Coordinates | 3174343..3174540 (-) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13444.56 Da Isoelectric Point: 5.1881
>T264173 WP_003405865.1 NZ_CP110674:c3174346-3173972 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|