Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VapB |
Location | 3173972..3174540 | Replicon | chromosome |
Accession | NZ_CP110674 | ||
Organism | Mycobacterium tuberculosis strain BLR-31d |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TH08 |
Locus tag | OO115_RS14820 | Protein ID | WP_003405865.1 |
Coordinates | 3173972..3174346 (-) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TH07 |
Locus tag | OO115_RS14825 | Protein ID | WP_003405863.1 |
Coordinates | 3174343..3174540 (-) | Length | 66 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO115_RS14785 (OO115_14785) | 3170322..3171092 | + | 771 | Protein_2925 | adenylate/guanylate cyclase domain-containing protein | - |
OO115_RS14790 (OO115_14790) | 3171044..3171253 | - | 210 | WP_003911400.1 | hypothetical protein | - |
OO115_RS14795 (OO115_14795) | 3171287..3171985 | + | 699 | WP_031646953.1 | hypothetical protein | - |
OO115_RS14800 (OO115_14800) | 3172000..3172323 | - | 324 | WP_003405871.1 | putative quinol monooxygenase | - |
OO115_RS14805 (OO115_14805) | 3172566..3172841 | + | 276 | WP_003405867.1 | hypothetical protein | - |
OO115_RS14810 (OO115_14810) | 3172768..3172953 | - | 186 | WP_003901093.1 | hypothetical protein | - |
OO115_RS14815 (OO115_14815) | 3173071..3173769 | - | 699 | WP_003898733.1 | hypothetical protein | - |
OO115_RS14820 (OO115_14820) | 3173972..3174346 | - | 375 | WP_003405865.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OO115_RS14825 (OO115_14825) | 3174343..3174540 | - | 198 | WP_003405863.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OO115_RS14830 (OO115_14830) | 3174628..3175701 | - | 1074 | WP_003898732.1 | redox-regulated ATPase YchF | - |
OO115_RS14835 (OO115_14835) | 3175764..3176747 | + | 984 | WP_003898731.1 | hypothetical protein | - |
OO115_RS14840 (OO115_14840) | 3176764..3177771 | - | 1008 | WP_003405853.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
OO115_RS14845 (OO115_14845) | 3177861..3178499 | + | 639 | WP_003898730.1 | lipid droplet-associated protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13444.56 Da Isoelectric Point: 5.1881
>T264173 WP_003405865.1 NZ_CP110674:c3174346-3173972 [Mycobacterium tuberculosis]
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
VILVDTSVWIEHLRAADARLVELLGDDEAGCHPLVIEELALGSIKQRDVVLDLLANLYQFPVVTHDEVLRLVGRRRLWGR
GLGAVDANLLGSVALVGGARLWTRDKRLKAACAESGVALAEEVS
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|