Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2951609..2952296 | Replicon | chromosome |
| Accession | NZ_CP110674 | ||
| Organism | Mycobacterium tuberculosis strain BLR-31d | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P65044 |
| Locus tag | OO115_RS13915 | Protein ID | WP_003414624.1 |
| Coordinates | 2951853..2952296 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TFH0 |
| Locus tag | OO115_RS13910 | Protein ID | WP_003414620.1 |
| Coordinates | 2951609..2951866 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO115_RS13890 (OO115_13890) | 2946929..2947783 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
| OO115_RS13895 (OO115_13895) | 2947839..2949002 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
| OO115_RS13900 (OO115_13900) | 2949019..2950233 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
| OO115_RS13905 (OO115_13905) | 2950241..2951482 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
| OO115_RS13910 (OO115_13910) | 2951609..2951866 | + | 258 | WP_003414620.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| OO115_RS13915 (OO115_13915) | 2951853..2952296 | + | 444 | WP_003414624.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OO115_RS13920 (OO115_13920) | 2952376..2953038 | + | 663 | WP_003414630.1 | cell surface glycolipoprotein Mpt83 | - |
| OO115_RS13925 (OO115_13925) | 2953134..2953325 | + | 192 | WP_003414632.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| OO115_RS13930 (OO115_13930) | 2953657..2955405 | + | 1749 | WP_003912869.1 | cytochrome c biogenesis protein DipZ | - |
| OO115_RS13935 (OO115_13935) | 2955501..2956082 | + | 582 | WP_003414644.1 | fasciclin domain-containing protein | - |
| OO115_RS13940 (OO115_13940) | 2956182..2956448 | + | 267 | WP_015456449.1 | DUF2631 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16595.72 Da Isoelectric Point: 6.4890
>T264172 WP_003414624.1 NZ_CP110674:2951853-2952296 [Mycobacterium tuberculosis]
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
MLCVDVNVLVYAHRADLREHADYRGLLERLANDDEPLGLPDSVLAGFIRVVTNRRVFTEPTSPQDAWQAVDALLAAPAAM
RLRPGERHWMAFRQLASDVDANGNDIADAHLAAYALENNATWLSADRGFARFRRLRWRHPLDGQTHL
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|