Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-Phd |
| Location | 2946008..2946556 | Replicon | chromosome |
| Accession | NZ_CP110674 | ||
| Organism | Mycobacterium tuberculosis strain BLR-31d | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | G0TFG5 |
| Locus tag | OO115_RS13885 | Protein ID | WP_003414602.1 |
| Coordinates | 2946293..2946556 (+) | Length | 88 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | O33347 |
| Locus tag | OO115_RS13880 | Protein ID | WP_003414599.1 |
| Coordinates | 2946008..2946289 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO115_RS13855 (OO115_13855) | 2941632..2942489 | - | 858 | WP_003899513.1 | type I methionyl aminopeptidase | - |
| OO115_RS13860 (OO115_13860) | 2942531..2943115 | - | 585 | WP_003414585.1 | DUF1707 domain-containing protein | - |
| OO115_RS13865 (OO115_13865) | 2943218..2943466 | + | 249 | WP_003913411.1 | antitoxin VapB23 | - |
| OO115_RS13870 (OO115_13870) | 2943463..2943843 | + | 381 | WP_003414592.1 | type II toxin-antitoxin system VapC family toxin | - |
| OO115_RS13875 (OO115_13875) | 2943925..2945736 | - | 1812 | WP_003414596.1 | penicillin-binding protein | - |
| OO115_RS13880 (OO115_13880) | 2946008..2946289 | + | 282 | WP_003414599.1 | type II toxin-antitoxin system antitoxin RelF | Antitoxin |
| OO115_RS13885 (OO115_13885) | 2946293..2946556 | + | 264 | WP_003414602.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OO115_RS13890 (OO115_13890) | 2946929..2947783 | - | 855 | WP_003899516.1 | GNAT family N-acetyltransferase | - |
| OO115_RS13895 (OO115_13895) | 2947839..2949002 | - | 1164 | WP_003899517.1 | flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase | - |
| OO115_RS13900 (OO115_13900) | 2949019..2950233 | - | 1215 | WP_003414610.1 | zinc metalloprotease Rip | - |
| OO115_RS13905 (OO115_13905) | 2950241..2951482 | - | 1242 | WP_003414613.1 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10204.82 Da Isoelectric Point: 11.5078
>T264171 WP_003414602.1 NZ_CP110674:2946293-2946556 [Mycobacterium tuberculosis]
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
VPYTVRFTTTARRDLHKLPPRILAAVVEFAFGDLSREPLRVGKPLRRELAGTFSARRGTYRLLYRIDDEHTTVVILRVDH
RADIYRR
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3G5O |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 3G5O | |
| AlphaFold DB | A0A7U4BWP8 |