Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN_Sll0205-like-Phd |
| Location | 2905091..2905695 | Replicon | chromosome |
| Accession | NZ_CP110674 | ||
| Organism | Mycobacterium tuberculosis strain BLR-31d | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | P71623 |
| Locus tag | OO115_RS13685 | Protein ID | WP_003414492.1 |
| Coordinates | 2905091..2905483 (-) | Length | 131 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A829CBY8 |
| Locus tag | OO115_RS13690 | Protein ID | WP_003414495.1 |
| Coordinates | 2905480..2905695 (-) | Length | 72 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO115_RS13655 (OO115_13655) | 2900241..2901029 | - | 789 | WP_003917092.1 | CRISPR-associated endoribonuclease Cas6 | - |
| OO115_RS13660 (OO115_13660) | 2901363..2901908 | - | 546 | WP_014584866.1 | DUF1802 family protein | - |
| OO115_RS13665 (OO115_13665) | 2902180..2903064 | - | 885 | WP_003414409.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| OO115_RS13670 (OO115_13670) | 2903067..2903954 | - | 888 | WP_003414414.1 | type IV toxin-antitoxin system AbiEi family antitoxin | - |
| OO115_RS13675 (OO115_13675) | 2904259..2904804 | - | 546 | WP_003910939.1 | DUF1802 family protein | - |
| OO115_RS13680 (OO115_13680) | 2904801..2905070 | - | 270 | WP_003414489.1 | DUF2277 family protein | - |
| OO115_RS13685 (OO115_13685) | 2905091..2905483 | - | 393 | WP_003414492.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OO115_RS13690 (OO115_13690) | 2905480..2905695 | - | 216 | WP_003414495.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OO115_RS13695 (OO115_13695) | 2905742..2906491 | + | 750 | WP_003902358.1 | enoyl-CoA hydratase | - |
| OO115_RS13700 (OO115_13700) | 2906570..2907652 | - | 1083 | WP_003414499.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
| OO115_RS13705 (OO115_13705) | 2907645..2908955 | - | 1311 | WP_003414501.1 | ABC transporter substrate-binding protein | - |
| OO115_RS13710 (OO115_13710) | 2908958..2909785 | - | 828 | WP_003414504.1 | carbohydrate ABC transporter permease | - |
| OO115_RS13715 (OO115_13715) | 2909782..2910693 | - | 912 | WP_003414505.1 | sugar ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14610.74 Da Isoelectric Point: 6.7594
>T264170 WP_003414492.1 NZ_CP110674:c2905483-2905091 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BWM8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CBY8 |