264170

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/PIN_Sll0205-like-Phd
Location 2905091..2905695 Replicon chromosome
Accession NZ_CP110674
Organism Mycobacterium tuberculosis strain BLR-31d

Toxin (Protein)


Gene name vapC Uniprot ID P71623
Locus tag OO115_RS13685 Protein ID WP_003414492.1
Coordinates 2905091..2905483 (-) Length 131 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A829CBY8
Locus tag OO115_RS13690 Protein ID WP_003414495.1
Coordinates 2905480..2905695 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO115_RS13655 (OO115_13655) 2900241..2901029 - 789 WP_003917092.1 CRISPR-associated endoribonuclease Cas6 -
OO115_RS13660 (OO115_13660) 2901363..2901908 - 546 WP_014584866.1 DUF1802 family protein -
OO115_RS13665 (OO115_13665) 2902180..2903064 - 885 WP_003414409.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
OO115_RS13670 (OO115_13670) 2903067..2903954 - 888 WP_003414414.1 type IV toxin-antitoxin system AbiEi family antitoxin -
OO115_RS13675 (OO115_13675) 2904259..2904804 - 546 WP_003910939.1 DUF1802 family protein -
OO115_RS13680 (OO115_13680) 2904801..2905070 - 270 WP_003414489.1 DUF2277 family protein -
OO115_RS13685 (OO115_13685) 2905091..2905483 - 393 WP_003414492.1 type II toxin-antitoxin system VapC family toxin Toxin
OO115_RS13690 (OO115_13690) 2905480..2905695 - 216 WP_003414495.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OO115_RS13695 (OO115_13695) 2905742..2906491 + 750 WP_003902358.1 enoyl-CoA hydratase -
OO115_RS13700 (OO115_13700) 2906570..2907652 - 1083 WP_003414499.1 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC -
OO115_RS13705 (OO115_13705) 2907645..2908955 - 1311 WP_003414501.1 ABC transporter substrate-binding protein -
OO115_RS13710 (OO115_13710) 2908958..2909785 - 828 WP_003414504.1 carbohydrate ABC transporter permease -
OO115_RS13715 (OO115_13715) 2909782..2910693 - 912 WP_003414505.1 sugar ABC transporter permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

VapC-like Sll0205 protein, PIN domain

(5-130)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(2-46)


Sequences

Toxin        


Download         Length: 131 a.a.        Molecular weight: 14610.74 Da        Isoelectric Point: 6.7594

>T264170 WP_003414492.1 NZ_CP110674:c2905483-2905091 [Mycobacterium tuberculosis]
MTTVLLDSHVAYWWSAEPQRLSMAASQAIEHADELAVAAISWFELAWLAEQERIQLAIPVLSWLQQLAEHVRTVGITPSV
AATAVALPSSFPGDPADRLIYATAIEHGWRLVTKDRRLRSHRHPRPVTVW

Download         Length: 393 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7511.55 Da        Isoelectric Point: 4.9732

>AT264170 WP_003414495.1 NZ_CP110674:c2905695-2905480 [Mycobacterium tuberculosis]
MTATEVKAKILSLLDEVAQGEEIEITKHGRTVARLVAATGPHALKGRFSGVAMAAVDDDELFTTGVSWNVS

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U4BWM8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CBY8

References