Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 2884893..2885463 | Replicon | chromosome |
| Accession | NZ_CP110674 | ||
| Organism | Mycobacterium tuberculosis strain BLR-31d | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | P71650 |
| Locus tag | OO115_RS13560 | Protein ID | WP_003414166.1 |
| Coordinates | 2884893..2885249 (-) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | P0CL61 |
| Locus tag | OO115_RS13565 | Protein ID | WP_003901465.1 |
| Coordinates | 2885233..2885463 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO115_RS13540 (OO115_13540) | 2880345..2882033 | - | 1689 | WP_003414155.1 | alpha/beta hydrolase family protein | - |
| OO115_RS13545 (OO115_13545) | 2882037..2882363 | - | 327 | WP_003414157.1 | hypothetical protein | - |
| OO115_RS13550 (OO115_13550) | 2882536..2883123 | + | 588 | WP_003914429.1 | DUF3558 family protein | - |
| OO115_RS13555 (OO115_13555) | 2883142..2884791 | + | 1650 | Protein_2681 | CocE/NonD family hydrolase | - |
| OO115_RS13560 (OO115_13560) | 2884893..2885249 | - | 357 | WP_003414166.1 | type II toxin-antitoxin system toxin endoribonuclease MazF9 | Toxin |
| OO115_RS13565 (OO115_13565) | 2885233..2885463 | - | 231 | WP_003901465.1 | type II toxin-antitoxin system antitoxin MazE9 | Antitoxin |
| OO115_RS13570 (OO115_13570) | 2885506..2886549 | - | 1044 | WP_003414172.1 | DUF2293 domain-containing protein | - |
| OO115_RS13575 (OO115_13575) | 2886548..2887015 | + | 468 | WP_003414177.1 | DUF1778 domain-containing protein | - |
| OO115_RS13580 (OO115_13580) | 2887191..2887445 | - | 255 | WP_003917684.1 | hypothetical protein | - |
| OO115_RS13585 (OO115_13585) | 2887593..2887997 | + | 405 | WP_003414181.1 | hypothetical protein | - |
| OO115_RS13590 (OO115_13590) | 2887994..2888185 | + | 192 | WP_003414184.1 | hypothetical protein | - |
| OO115_RS13595 (OO115_13595) | 2888402..2888662 | + | 261 | Protein_2689 | transposase | - |
| OO115_RS13600 (OO115_13600) | 2889772..2890029 | + | 258 | WP_003899489.1 | hypothetical protein | - |
| OO115_RS13605 (OO115_13605) | 2890134..2890445 | + | 312 | WP_003414190.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 12858.73 Da Isoelectric Point: 9.1962
>T264168 WP_003414166.1 NZ_CP110674:c2885249-2884893 [Mycobacterium tuberculosis]
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
VMRRGEIWQVDLDPARGSEANNQRPAVVVSNDRANATATRLGRGVITVVPVTSNIAKVYPFQVLLSATTTGLQVDCKAQA
EQIRSIATERLLRPIGRVSAAELAQLDEALKLHLDLWS
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|