Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VapB
Location 2845309..2845996 Replicon chromosome
Accession NZ_CP110674
Organism Mycobacterium tuberculosis strain BLR-31d

Toxin (Protein)


Gene name vapC Uniprot ID G0TF65
Locus tag OO115_RS13340 Protein ID WP_003414064.1
Coordinates 2845601..2845996 (-) Length 132 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID G0TF64
Locus tag OO115_RS13335 Protein ID WP_003414061.1
Coordinates 2845309..2845575 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO115_RS13305 (OO115_13305) 2840948..2841850 - 903 WP_003900564.1 4-hydroxy-tetrahydrodipicolinate synthase -
OO115_RS13310 (OO115_13310) 2841919..2842671 - 753 WP_003899465.1 FAD-dependent thymidylate synthase -
OO115_RS13315 (OO115_13315) 2842698..2842835 - 138 Protein_2633 type II toxin-antitoxin system VapC family toxin -
OO115_RS13320 (OO115_13320) 2842915..2843190 - 276 WP_003414055.1 type I restriction endonuclease subunit S -
OO115_RS13325 (OO115_13325) 2843187..2844809 - 1623 WP_003414057.1 class I SAM-dependent DNA methyltransferase -
OO115_RS13330 (OO115_13330) 2844896..2845312 - 417 Protein_2636 type II toxin-antitoxin system toxin ribonuclease C21 -
OO115_RS13335 (OO115_13335) 2845309..2845575 - 267 WP_003414061.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OO115_RS13340 (OO115_13340) 2845601..2845996 - 396 WP_003414064.1 type II toxin-antitoxin system VapC family toxin Toxin
OO115_RS13345 (OO115_13345) 2845993..2846262 - 270 WP_003414066.1 type II toxin-antitoxin system VapB family antitoxin -
OO115_RS13350 (OO115_13350) 2846272..2847366 - 1095 WP_003414068.1 restriction endonuclease subunit S -
OO115_RS13355 (OO115_13355) 2847363..2847782 - 420 WP_003414070.1 winged helix-turn-helix domain-containing protein -
OO115_RS13360 (OO115_13360) 2847781..2847855 + 75 Protein_2642 hypothetical protein -
OO115_RS13365 (OO115_13365) 2847856..2848335 - 480 WP_003414073.1 dihydrofolate reductase -
OO115_RS13370 (OO115_13370) 2848406..2849206 - 801 WP_003911953.1 thymidylate synthase -
OO115_RS13375 (OO115_13375) 2849362..2850099 + 738 WP_003414079.1 dienelactone hydrolase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(1-125)

Antitoxin

Bacterial antitoxin of type II TA system, VapB

(16-56)


Sequences

Toxin        


Download         Length: 132 a.a.        Molecular weight: 14340.04 Da        Isoelectric Point: 4.7145

>T264167 WP_003414064.1 NZ_CP110674:c2845996-2845601 [Mycobacterium tuberculosis]
VIVDTSAIVAIVSGESGAQVLKEALERSPNSRMSAPNYVELCAIMQRRDRPEISRLVDRLLDDYGIQVEAVDADQARVAA
QAYRDYGRGSGHPARLNLGDTYSYALAQVTGEPLLFRGDDFTHTDIRPACT

Download         Length: 396 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9493.77 Da        Isoelectric Point: 7.2783

>AT264167 WP_003414061.1 NZ_CP110674:c2845575-2845309 [Mycobacterium tuberculosis]
MHRGYALVVCSPGVTRTMIDIDDDLLARAAKELGTTTKKDTVHAALRAALRASAARSLMNRMAENATGTQDEALVNAMWR
DGHPENTA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TF65

Antitoxin

Source ID Structure
AlphaFold DB G0TF64

References