Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2704546..2705260 | Replicon | chromosome |
| Accession | NZ_CP110674 | ||
| Organism | Mycobacterium tuberculosis strain BLR-31d | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0TQK0 |
| Locus tag | OO115_RS12500 | Protein ID | WP_003413460.1 |
| Coordinates | 2704820..2705260 (+) | Length | 147 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | P9WJ20 |
| Locus tag | OO115_RS12495 | Protein ID | WP_003413456.1 |
| Coordinates | 2704546..2704833 (+) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO115_RS12460 (OO115_12460) | 2699968..2700213 | + | 246 | WP_003413429.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| OO115_RS12465 (OO115_12465) | 2700210..2700614 | + | 405 | WP_003413432.1 | type II toxin-antitoxin system VapC family toxin | - |
| OO115_RS12470 (OO115_12470) | 2700831..2701451 | + | 621 | WP_003413441.1 | DUF4178 domain-containing protein | - |
| OO115_RS12475 (OO115_12475) | 2701462..2701956 | + | 495 | WP_003413444.1 | DUF2617 family protein | - |
| OO115_RS12480 (OO115_12480) | 2701953..2702384 | + | 432 | WP_003899390.1 | DUF4247 domain-containing protein | - |
| OO115_RS12485 (OO115_12485) | 2702409..2702867 | + | 459 | WP_003413451.1 | DUF350 domain-containing protein | - |
| OO115_RS12490 (OO115_12490) | 2702864..2704435 | + | 1572 | WP_003899392.1 | polyamine aminopropyltransferase | - |
| OO115_RS12495 (OO115_12495) | 2704546..2704833 | + | 288 | WP_003413456.1 | antitoxin VapB41 | Antitoxin |
| OO115_RS12500 (OO115_12500) | 2704820..2705260 | + | 441 | WP_003413460.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OO115_RS12505 (OO115_12505) | 2705281..2706036 | - | 756 | WP_003413464.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
| OO115_RS12510 (OO115_12510) | 2706169..2706765 | - | 597 | WP_003413465.1 | pyridoxal 5'-phosphate synthase glutaminase subunit PdxT | - |
| OO115_RS12515 (OO115_12515) | 2706773..2707618 | - | 846 | WP_003413466.1 | acyl-CoA thioesterase II | - |
| OO115_RS12520 (OO115_12520) | 2707647..2708546 | - | 900 | WP_003413468.1 | pyridoxal 5'-phosphate synthase lyase subunit PdxS | - |
| OO115_RS12525 (OO115_12525) | 2708674..2709348 | + | 675 | WP_003413471.1 | pyridoxamine 5'-phosphate oxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 16026.38 Da Isoelectric Point: 6.8599
>T264165 WP_003413460.1 NZ_CP110674:2704820-2705260 [Mycobacterium tuberculosis]
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
MLLCDTNIWLALALSGHVHHRASRAWLDTINAPGVIHFCRATQQSLLRLLTNRTVLGAYGSPPLTNREAWAAYAAFLDDD
RIVLAGAEPDGLEAQWRAFAVRQSPAPKVWMDAYLAAFALTGGFELVTTDTAFTQYGGIELRLLAK
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | G0TQK0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U4BWB8 |