Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 2643083..2643714 | Replicon | chromosome |
Accession | NZ_CP110674 | ||
Organism | Mycobacterium tuberculosis strain BLR-31d |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQ28 |
Locus tag | OO115_RS12225 | Protein ID | WP_003413174.1 |
Coordinates | 2643337..2643714 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P95006 |
Locus tag | OO115_RS12220 | Protein ID | WP_003413167.1 |
Coordinates | 2643083..2643340 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO115_RS12190 (OO115_12190) | 2638998..2639312 | + | 315 | WP_009937839.1 | hypothetical protein | - |
OO115_RS12195 (OO115_12195) | 2639608..2640819 | + | 1212 | WP_003900845.1 | alpha/beta hydrolase family protein | - |
OO115_RS12200 (OO115_12200) | 2640946..2641605 | + | 660 | WP_003902296.1 | LppA family lipoprotein | - |
OO115_RS12205 (OO115_12205) | 2641602..2642264 | + | 663 | WP_003905878.1 | LppA family lipoprotein | - |
OO115_RS12210 (OO115_12210) | 2642261..2642538 | + | 278 | Protein_2416 | type II toxin-antitoxin system VapB family antitoxin | - |
OO115_RS12215 (OO115_12215) | 2642631..2643044 | + | 414 | WP_003413164.1 | PIN domain nuclease | - |
OO115_RS12220 (OO115_12220) | 2643083..2643340 | + | 258 | WP_003413167.1 | CopG family transcriptional regulator | Antitoxin |
OO115_RS12225 (OO115_12225) | 2643337..2643714 | + | 378 | WP_003413174.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OO115_RS12230 (OO115_12230) | 2643730..2644104 | - | 375 | WP_003413177.1 | hypothetical protein | - |
OO115_RS12235 (OO115_12235) | 2644204..2644599 | - | 396 | WP_003413180.1 | type II toxin-antitoxin system toxin 23S rRNA-specific endonuclease VapC20 | - |
OO115_RS12240 (OO115_12240) | 2644596..2644841 | - | 246 | WP_003413183.1 | type II toxin-antitoxin system antitoxin VapB20 | - |
OO115_RS12245 (OO115_12245) | 2645252..2645671 | - | 420 | WP_003413190.1 | A24 family peptidase | - |
OO115_RS12250 (OO115_12250) | 2645683..2646492 | - | 810 | WP_003413193.1 | shikimate dehydrogenase | - |
OO115_RS12255 (OO115_12255) | 2646489..2647742 | - | 1254 | WP_003413196.1 | endolytic transglycosylase MltG | - |
OO115_RS12260 (OO115_12260) | 2647735..2648247 | - | 513 | WP_003413197.1 | Holliday junction resolvase RuvX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13728.72 Da Isoelectric Point: 4.4687
>T264163 WP_003413174.1 NZ_CP110674:2643337-2643714 [Mycobacterium tuberculosis]
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
VKLIDTTIAVDHLRGEPAAAVLLAELINNGEEIAASELVRFELLAGVRESELAALEAFFSAVVWTLVTEDIARIGGRLAR
RYRSSHRGIDDVDYLIAATAIVVDADLLTTNVRHFPMFPDLQPPY
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TQ28 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C9W5 |