Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 2628745..2629385 | Replicon | chromosome |
Accession | NZ_CP110674 | ||
Organism | Mycobacterium tuberculosis strain BLR-31d |
Toxin (Protein)
Gene name | vapC | Uniprot ID | G0TQ08 |
Locus tag | OO115_RS12130 | Protein ID | WP_003412970.1 |
Coordinates | 2628745..2629164 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TQ09 |
Locus tag | OO115_RS12135 | Protein ID | WP_003412975.1 |
Coordinates | 2629161..2629385 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO115_RS12100 (OO115_12100) | 2624335..2625057 | - | 723 | WP_003412957.1 | DUF1906 domain-containing protein | - |
OO115_RS12105 (OO115_12105) | 2625574..2625796 | + | 223 | Protein_2395 | type II toxin-antitoxin system VapB family antitoxin | - |
OO115_RS12110 (OO115_12110) | 2625793..2626194 | + | 402 | WP_003412963.1 | PIN domain-containing protein | - |
OO115_RS12115 (OO115_12115) | 2626229..2627149 | - | 921 | WP_003412965.1 | restriction endonuclease | - |
OO115_RS12120 (OO115_12120) | 2627490..2627735 | - | 246 | WP_071854223.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
OO115_RS12125 (OO115_12125) | 2627794..2628744 | + | 951 | WP_003911916.1 | ERCC4 domain-containing protein | - |
OO115_RS12130 (OO115_12130) | 2628745..2629164 | - | 420 | WP_003412970.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OO115_RS12135 (OO115_12135) | 2629161..2629385 | - | 225 | WP_003412975.1 | antitoxin VapB39 | Antitoxin |
OO115_RS12140 (OO115_12140) | 2629416..2632259 | - | 2844 | WP_003899363.1 | aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | - |
OO115_RS12145 (OO115_12145) | 2632331..2632732 | - | 402 | WP_003412981.1 | hypothetical protein | - |
OO115_RS12150 (OO115_12150) | 2632732..2633202 | - | 471 | WP_003899364.1 | transcription antitermination factor NusB | - |
OO115_RS12155 (OO115_12155) | 2633205..2633768 | - | 564 | WP_003412989.1 | elongation factor P | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14732.70 Da Isoelectric Point: 6.7519
>T264161 WP_003412970.1 NZ_CP110674:c2629164-2628745 [Mycobacterium tuberculosis]
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
VTALLDVNVLIALGWPNHVHHAAAQRWFTQFSSNGWATTPITEAGYVRISSNRSVMQVSTTPAIAIAQLAAMTSLAGHTF
WPDDVPLIVGSAGDRDAVSNHRRVTDCHLIALAARYGGRLVTFDAALADSASAGLVEVL
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|