Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/-
Location 2180000..2180529 Replicon chromosome
Accession NZ_CP110674
Organism Mycobacterium tuberculosis strain BLR-31d

Toxin (Protein)


Gene name parE Uniprot ID G0TMR4
Locus tag OO115_RS10030 Protein ID WP_003411124.1
Coordinates 2180000..2180317 (-) Length 106 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID P9WJ74
Locus tag OO115_RS10035 Protein ID WP_003411127.1
Coordinates 2180314..2180529 (-) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OO115_RS10000 (OO115_10000) 2175021..2176097 + 1077 WP_003411110.1 hypothetical protein -
OO115_RS10005 (OO115_10005) 2176094..2176375 + 282 WP_003411112.1 DUF5703 family protein -
OO115_RS10010 (OO115_10010) 2176411..2177484 + 1074 WP_003901338.1 quinone-dependent dihydroorotate dehydrogenase -
OO115_RS10015 (OO115_10015) 2177489..2178019 - 531 WP_003411119.1 YbhB/YbcL family Raf kinase inhibitor-like protein -
OO115_RS10020 (OO115_10020) 2178067..2179413 - 1347 WP_003411121.1 M20/M25/M40 family metallo-hydrolase -
OO115_RS10030 (OO115_10030) 2180000..2180317 - 318 WP_003411124.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OO115_RS10035 (OO115_10035) 2180314..2180529 - 216 WP_003411127.1 antitoxin ParD2 Antitoxin
OO115_RS10040 (OO115_10040) 2180784..2181842 + 1059 WP_003411129.1 phosphoribosyltransferase family protein -
OO115_RS10045 (OO115_10045) 2181972..2182328 - 357 WP_003411130.1 hypothetical protein -
OO115_RS10050 (OO115_10050) 2182423..2183205 - 783 WP_003411131.1 cell wall synthesis protein Wag31 -
OO115_RS10055 (OO115_10055) 2183473..2183763 - 291 WP_003900476.1 YggT family protein -
OO115_RS10060 (OO115_10060) 2183925..2184581 - 657 WP_003411133.1 cell division protein SepF -
OO115_RS10065 (OO115_10065) 2184643..2185422 - 780 WP_015575160.1 YggS family pyridoxal phosphate-dependent enzyme -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-92)

Antitoxin

Conserved hypothetical protein CHP02574, addiction module

(11-69)


Sequences

Toxin        


Download         Length: 106 a.a.        Molecular weight: 12312.88 Da        Isoelectric Point: 6.4831

>T264159 WP_003411124.1 NZ_CP110674:c2180317-2180000 [Mycobacterium tuberculosis]
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYRHIYLRPFRYYVAYRTTDEAI
DILAVRHGMENPNAVEAEISGRTFE

Download         Length: 318 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 7880.70 Da        Isoelectric Point: 4.4055

>AT264159 WP_003411127.1 NZ_CP110674:c2180529-2180314 [Mycobacterium tuberculosis]
VVVNRALLASVDALSRDEQIELVEHINGNLAEGMHISEANQALIEARANDTDDAHWSTIDDFDKRIRARLG

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G0TMR4

Antitoxin

Source ID Structure
AlphaFold DB A0A7U4FAJ4

References