Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 2140364..2141059 | Replicon | chromosome |
| Accession | NZ_CP110674 | ||
| Organism | Mycobacterium tuberculosis strain BLR-31d | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | OO115_RS09815 | Protein ID | WP_003905754.1 |
| Coordinates | 2140364..2140798 (-) | Length | 145 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0TMN0 |
| Locus tag | OO115_RS09820 | Protein ID | WP_003410814.1 |
| Coordinates | 2140805..2141059 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OO115_RS09805 (OO115_09805) | 2136518..2139559 | + | 3042 | WP_003899171.1 | DEAD/DEAH box helicase | - |
| OO115_RS09810 (OO115_09810) | 2139552..2140385 | + | 834 | WP_003899172.1 | SWIM zinc finger family protein | - |
| OO115_RS09815 (OO115_09815) | 2140364..2140798 | - | 435 | WP_003905754.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OO115_RS09820 (OO115_09820) | 2140805..2141059 | - | 255 | WP_003410814.1 | antitoxin | Antitoxin |
| OO115_RS09825 (OO115_09825) | 2141075..2141332 | - | 258 | WP_003410816.1 | hypothetical protein | - |
| OO115_RS09830 (OO115_09830) | 2141866..2143127 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
| OO115_RS09840 (OO115_09840) | 2144995..2145291 | + | 297 | WP_003410820.1 | PE family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2133009..2144790 | 11781 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15632.05 Da Isoelectric Point: 7.4681
>T264158 WP_003905754.1 NZ_CP110674:c2140798-2140364 [Mycobacterium tuberculosis]
MKIVDANVLLYAVNTASEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
MKIVDANVLLYAVNTASEHHKPSLRWLDGALSGADRVGFAWVPLLAFVRLATKVGLFPRPLPREAAITQVADWLAAPSAV
LVNPTVRHADILARMLTYVGTGANLVNDAHLAALAVEHRASIVSYDSDFGRFEGVRWDQPPALL
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|