Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PemK(toxin) |
Location | 2097030..2097666 | Replicon | chromosome |
Accession | NZ_CP110674 | ||
Organism | Mycobacterium tuberculosis strain BLR-31d |
Toxin (Protein)
Gene name | mazF | Uniprot ID | P0CL62 |
Locus tag | OO115_RS09620 | Protein ID | WP_003410654.1 |
Coordinates | 2097256..2097666 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | P9WJ84 |
Locus tag | OO115_RS09615 | Protein ID | WP_003410651.1 |
Coordinates | 2097030..2097263 (+) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO115_RS09600 (OO115_09600) | 2092478..2092879 | + | 402 | WP_009937711.1 | metal ABC transporter permease | - |
OO115_RS09605 (OO115_09605) | 2092880..2093284 | - | 405 | WP_003410645.1 | PPOX class F420-dependent oxidoreductase | - |
OO115_RS09610 (OO115_09610) | 2093368..2096952 | - | 3585 | WP_003910889.1 | cobaltochelatase subunit CobN | - |
OO115_RS09615 (OO115_09615) | 2097030..2097263 | + | 234 | WP_003410651.1 | type II toxin-antitoxin system antitoxin MazE7 | Antitoxin |
OO115_RS09620 (OO115_09620) | 2097256..2097666 | + | 411 | WP_003410654.1 | type II toxin-antitoxin system toxin endoribonuclease MazF7 | Toxin |
OO115_RS09625 (OO115_09625) | 2097650..2098741 | + | 1092 | WP_003900454.1 | precorrin-3B synthase | - |
OO115_RS09630 (OO115_09630) | 2098751..2099377 | + | 627 | WP_003410658.1 | precorrin-8X methylmutase | - |
OO115_RS09635 (OO115_09635) | 2099374..2100900 | + | 1527 | WP_003410659.1 | precorrin-2 C(20)-methyltransferase | - |
OO115_RS09640 (OO115_09640) | 2100846..2102069 | - | 1224 | WP_003901321.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14235.42 Da Isoelectric Point: 10.6228
>T264157 WP_003410654.1 NZ_CP110674:2097256-2097666 [Mycobacterium tuberculosis]
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
MAEPRRGDLWLVSLGAARAGEPGKHRPAVVVSVDELLTGIDDELVVVVPVSSSRSRTPLRPPVAPSEGVAADSVAVCRGV
RAVARARLVERLGALKPATMRAIENALTLILGLPTGPERGEAATHSPVRWTGGRDP
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 7DU4 | |
PDB | 5WYG | |
PDB | 6A6X |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BV50 |