Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mbcAT/RES-TIGR02293 |
Location | 2002583..2003481 | Replicon | chromosome |
Accession | NZ_CP110674 | ||
Organism | Mycobacterium tuberculosis strain BLR-31d |
Toxin (Protein)
Gene name | mbcT | Uniprot ID | P64908 |
Locus tag | OO115_RS09195 | Protein ID | WP_003410001.1 |
Coordinates | 2002583..2003143 (-) | Length | 187 a.a. |
Antitoxin (Protein)
Gene name | mbcA | Uniprot ID | P64910 |
Locus tag | OO115_RS09200 | Protein ID | WP_003410003.1 |
Coordinates | 2003140..2003481 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO115_RS09165 (OO115_09165) | 1997752..1998405 | - | 654 | WP_003409976.1 | cutinase Cfp21 | - |
OO115_RS09170 (OO115_09170) | 1998520..1998750 | + | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
OO115_RS09175 (OO115_09175) | 1998835..1999746 | - | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
OO115_RS09180 (OO115_09180) | 1999855..2000454 | + | 600 | WP_003910883.1 | L-lysine exporter | - |
OO115_RS09185 (OO115_09185) | 2000870..2001298 | + | 429 | WP_003409992.1 | cellulose-binding protein | - |
OO115_RS09190 (OO115_09190) | 2001524..2002063 | + | 540 | WP_003900446.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(37) | - |
OO115_RS09195 (OO115_09195) | 2002583..2003143 | - | 561 | WP_003410001.1 | RES family NAD+ phosphorylase | Toxin |
OO115_RS09200 (OO115_09200) | 2003140..2003481 | - | 342 | WP_003410003.1 | DUF2384 domain-containing protein | Antitoxin |
OO115_RS09205 (OO115_09205) | 2003567..2003824 | + | 258 | WP_003410006.1 | hypothetical protein | - |
OO115_RS09210 (OO115_09210) | 2003725..2004060 | - | 336 | WP_003410009.1 | dehydrogenase | - |
OO115_RS09215 (OO115_09215) | 2004149..2004493 | - | 345 | WP_003410010.1 | type II toxin-antitoxin system toxin endoribonuclease MazF6 | - |
OO115_RS09220 (OO115_09220) | 2004487..2004735 | - | 249 | WP_003410014.1 | ribbon-helix-helix protein, CopG family | - |
OO115_RS09225 (OO115_09225) | 2004835..2007150 | - | 2316 | WP_003899120.1 | cation transporter ATPase CptG | - |
OO115_RS09230 (OO115_09230) | 2007147..2007419 | - | 273 | WP_003410017.1 | DUF1490 family protein | - |
OO115_RS09235 (OO115_09235) | 2007472..2007828 | - | 357 | WP_003410018.1 | Cd(II)/Pb(II)-sensing metalloregulatory transcriptional regulator CmtR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 187 a.a. Molecular weight: 20248.70 Da Isoelectric Point: 4.5091
>T264153 WP_003410001.1 NZ_CP110674:c2003143-2002583 [Mycobacterium tuberculosis]
VSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLADSAQACMVEVERAAQAASTT
AEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDIYGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQ
RTRPGQLQLRQSVDLTPALYQELRAT
VSDALDEGLVQRIDARGTIEWSETCYRYTGAHRDALSGEGARRFGGRWNPPLLFPAIYLADSAQACMVEVERAAQAASTT
AEKMLEAAYRLHTIDVTDLAVLDLTTPQAREAVGLENDDIYGDDWSGCQAVGHAAWFLHMQGVLVPAAGGVGLVVTAYEQ
RTRPGQLQLRQSVDLTPALYQELRAT
Download Length: 561 bp
Antitoxin
Download Length: 114 a.a. Molecular weight: 12488.33 Da Isoelectric Point: 4.8359
>AT264153 WP_003410003.1 NZ_CP110674:c2003481-2003140 [Mycobacterium tuberculosis]
MGVNVLASTVSGAIERLGLTYEEVGDIVDASPRSVARWTAGQVVPQRLNKQRLIELAYVADALAEVLPRDQANVWMFSPN
RLLEHRKPADLVRDGEYQRVLALIDAMAEGVFV
MGVNVLASTVSGAIERLGLTYEEVGDIVDASPRSVARWTAGQVVPQRLNKQRLIELAYVADALAEVLPRDQANVWMFSPN
RLLEHRKPADLVRDGEYQRVLALIDAMAEGVFV
Download Length: 342 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|