Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
Location | 1995257..1995945 | Replicon | chromosome |
Accession | NZ_CP110674 | ||
Organism | Mycobacterium tuberculosis strain BLR-31d |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P0A653 |
Locus tag | OO115_RS09150 | Protein ID | WP_003409958.1 |
Coordinates | 1995257..1995676 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | P9WJ28 |
Locus tag | OO115_RS09155 | Protein ID | WP_003409968.1 |
Coordinates | 1995685..1995945 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO115_RS09125 (OO115_09125) | 1991112..1991324 | - | 213 | Protein_1809 | class I SAM-dependent methyltransferase | - |
OO115_RS09130 (OO115_09130) | 1991328..1991600 | + | 273 | Protein_1810 | SAM-dependent methyltransferase | - |
OO115_RS09135 (OO115_09135) | 1991563..1993008 | - | 1446 | WP_003899115.1 | APC family permease | - |
OO115_RS09140 (OO115_09140) | 1993187..1993873 | - | 687 | WP_003409954.1 | immunoprotective protein Mpt64 | - |
OO115_RS09145 (OO115_09145) | 1994064..1995032 | - | 969 | WP_003899116.1 | class 1b ribonucleoside-diphosphate reductase subunit beta | - |
OO115_RS09150 (OO115_09150) | 1995257..1995676 | - | 420 | WP_003409958.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OO115_RS09155 (OO115_09155) | 1995685..1995945 | - | 261 | WP_003409968.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OO115_RS09160 (OO115_09160) | 1996088..1997764 | + | 1677 | WP_003899118.1 | PecA family PE domain-processing aspartic protease | - |
OO115_RS09165 (OO115_09165) | 1997752..1998405 | - | 654 | WP_003409976.1 | cutinase Cfp21 | - |
OO115_RS09170 (OO115_09170) | 1998520..1998750 | + | 231 | WP_003409980.1 | DUF167 domain-containing protein | - |
OO115_RS09175 (OO115_09175) | 1998835..1999746 | - | 912 | WP_003409986.1 | ArgP/LysG family DNA-binding transcriptional regulator | - |
OO115_RS09180 (OO115_09180) | 1999855..2000454 | + | 600 | WP_003910883.1 | L-lysine exporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14724.89 Da Isoelectric Point: 7.9535
>T264152 WP_003409958.1 NZ_CP110674:c1995676-1995257 [Mycobacterium tuberculosis]
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
MIVDTSAVVALVQGERPHATLVAAALAGAHSPVMSAPTVAECLIVLTARHGPVARTIFERLRSEIGLSVSSFTAEHAAAT
QRAFLRYGKGRHRAALNFGDCMTYATAQLGHQPLLAVGNDFPQTDLEFRGVVGYWPGVA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C4H9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829C483 |