Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 1970785..1971329 | Replicon | chromosome |
Accession | NZ_CP110674 | ||
Organism | Mycobacterium tuberculosis strain BLR-31d |
Toxin (Protein)
Gene name | parE | Uniprot ID | G0TLU9 |
Locus tag | OO115_RS09010 | Protein ID | WP_003409896.1 |
Coordinates | 1970785..1971081 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | P67299 |
Locus tag | OO115_RS09015 | Protein ID | WP_003409899.1 |
Coordinates | 1971078..1971329 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO115_RS08955 (OO115_08955) | 1965818..1966168 | - | 351 | WP_003409871.1 | hypothetical protein | - |
OO115_RS08960 (OO115_08960) | 1966179..1967081 | - | 903 | WP_003899097.1 | hypothetical protein | - |
OO115_RS08965 (OO115_08965) | 1967102..1967293 | - | 192 | WP_003409876.1 | hypothetical protein | - |
OO115_RS08970 (OO115_08970) | 1967294..1967590 | - | 297 | WP_003409877.1 | hypothetical protein | - |
OO115_RS08975 (OO115_08975) | 1967830..1968045 | + | 216 | WP_003409878.1 | antitoxin | - |
OO115_RS08980 (OO115_08980) | 1968042..1968353 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
OO115_RS08985 (OO115_08985) | 1968327..1968848 | - | 522 | WP_003904745.1 | hypothetical protein | - |
OO115_RS08990 (OO115_08990) | 1968823..1969200 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | - |
OO115_RS08995 (OO115_08995) | 1969242..1969691 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | - |
OO115_RS09000 (OO115_09000) | 1969688..1970233 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
OO115_RS09005 (OO115_09005) | 1970122..1970736 | - | 615 | WP_003901296.1 | hypothetical protein | - |
OO115_RS09010 (OO115_09010) | 1970785..1971081 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OO115_RS09015 (OO115_09015) | 1971078..1971329 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
OO115_RS09020 (OO115_09020) | 1971316..1971810 | + | 495 | WP_003899099.1 | hypothetical protein | - |
OO115_RS09025 (OO115_09025) | 1971970..1972377 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
OO115_RS09030 (OO115_09030) | 1972381..1972653 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
OO115_RS09035 (OO115_09035) | 1972686..1973906 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
OO115_RS09040 (OO115_09040) | 1974805..1975602 | + | 798 | WP_003899101.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11268.64 Da Isoelectric Point: 6.8604
>T264151 WP_003409896.1 NZ_CP110674:c1971081-1970785 [Mycobacterium tuberculosis]
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL
VSSRYLLSPAAQAHLEEIWDCTYDRWGVDQAEQYLRELQHAIDRAAANPRIGRACDEIRPGYRKLSAGSHTLFYRVTGEG
TIDVVRVLHQRMDVDRNL
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TLU9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BUZ2 |