Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 1468771..1469387 | Replicon | chromosome |
Accession | NZ_CP110674 | ||
Organism | Mycobacterium tuberculosis strain BLR-31d |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G0TJ74 |
Locus tag | OO115_RS06740 | Protein ID | WP_003407593.1 |
Coordinates | 1469070..1469387 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G0TJ73 |
Locus tag | OO115_RS06735 | Protein ID | WP_003900349.1 |
Coordinates | 1468771..1469073 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO115_RS06725 (OO115_06725) | 1464657..1466504 | + | 1848 | WP_003407585.1 | methylmalonyl-CoA mutase small subunit | - |
OO115_RS06730 (OO115_06730) | 1466505..1468757 | + | 2253 | WP_003407587.1 | methylmalonyl-CoA mutase | - |
OO115_RS06735 (OO115_06735) | 1468771..1469073 | + | 303 | WP_003900349.1 | type II toxin-antitoxin system antitoxin MazE4 | Antitoxin |
OO115_RS06740 (OO115_06740) | 1469070..1469387 | + | 318 | WP_003407593.1 | type II toxin-antitoxin system toxin endoribonuclease MazF4 | Toxin |
OO115_RS06745 (OO115_06745) | 1469384..1470388 | + | 1005 | WP_003407596.1 | methylmalonyl Co-A mutase-associated GTPase MeaB | - |
OO115_RS06750 (OO115_06750) | 1470441..1471730 | + | 1290 | WP_003902090.1 | serine hydrolase domain-containing protein | - |
OO115_RS06755 (OO115_06755) | 1471803..1472528 | - | 726 | WP_003898898.1 | class I SAM-dependent methyltransferase | - |
OO115_RS06760 (OO115_06760) | 1472634..1472846 | - | 213 | WP_003898900.1 | dodecin family protein | - |
OO115_RS06765 (OO115_06765) | 1472907..1473305 | + | 399 | WP_003900351.1 | hypothetical protein | - |
OO115_RS06770 (OO115_06770) | 1473350..1474378 | + | 1029 | WP_003407612.1 | glycosyltransferase family 2 protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11377.97 Da Isoelectric Point: 7.9950
>T264145 WP_003407593.1 NZ_CP110674:1469070-1469387 [Mycobacterium tuberculosis]
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
VNAPLRGQVYRCDLGYGAKPWLIVSNNARNRHTADVVAVRLTTTRRTIPTWVAMGPSDPLTGYVNADNIETLGKDELGDY
LGEVTPATMNKINTALATALGLPWP
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|