Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
| Location | 1163495..1164183 | Replicon | chromosome |
| Accession | NZ_CP110674 | ||
| Organism | Mycobacterium tuberculosis strain BLR-31d | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | G0THR7 |
| Locus tag | OO115_RS05400 | Protein ID | WP_003406304.1 |
| Coordinates | 1163752..1164183 (+) | Length | 144 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | G0THR6 |
| Locus tag | OO115_RS05395 | Protein ID | WP_003406302.1 |
| Coordinates | 1163495..1163755 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 144 a.a. Molecular weight: 15873.08 Da Isoelectric Point: 5.8838
>T264141 WP_003406304.1 NZ_CP110674:1163752-1164183 [Mycobacterium tuberculosis]
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
VIIPDINLLLYAVITGFPQHRRAHAWWQDTVNGHTRIGLTYPALFGFLRIATSARVLAAPLPTADAIAYVREWLSQPNVD
LLTAGPRHLDIALGLLDKLGTASHLTTDVQLAAYGIEYDAEIHSSDTDFARFADLKWTDPLRE
Download Length: 432 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|