Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN(toxin) |
Location | 708998..709672 | Replicon | chromosome |
Accession | NZ_CP110674 | ||
Organism | Mycobacterium tuberculosis strain BLR-31d |
Toxin (Protein)
Gene name | vapC | Uniprot ID | P9WF52 |
Locus tag | OO115_RS03235 | Protein ID | WP_003417282.1 |
Coordinates | 709244..709672 (+) | Length | 143 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | G0TI59 |
Locus tag | OO115_RS03230 | Protein ID | WP_003417286.1 |
Coordinates | 708998..709240 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OO115_RS03205 (OO115_03205) | 705462..706598 | + | 1137 | WP_003417297.1 | GTP 3',8-cyclase MoaA | - |
OO115_RS03210 (OO115_03210) | 706695..707069 | + | 375 | WP_003417295.1 | 4a-hydroxytetrahydrobiopterin dehydratase | - |
OO115_RS03215 (OO115_03215) | 707066..707599 | + | 534 | WP_003417293.1 | cyclic pyranopterin monophosphate synthase MoaC | - |
OO115_RS03220 (OO115_03220) | 707600..708265 | + | 666 | WP_003417290.1 | molybdopterin converting factor subunit 1 | - |
OO115_RS03225 (OO115_03225) | 708262..708876 | + | 615 | WP_003417288.1 | class I SAM-dependent methyltransferase | - |
OO115_RS03230 (OO115_03230) | 708998..709240 | + | 243 | WP_003417286.1 | CopG family transcriptional regulator | Antitoxin |
OO115_RS03235 (OO115_03235) | 709244..709672 | + | 429 | WP_003417282.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OO115_RS03240 (OO115_03240) | 709751..710542 | - | 792 | WP_003417279.1 | succinate dehydrogenase iron-sulfur subunit | - |
OO115_RS03245 (OO115_03245) | 710542..712314 | - | 1773 | WP_003417273.1 | succinate dehydrogenase flavoprotein subunit | - |
OO115_RS03250 (OO115_03250) | 712443..712877 | - | 435 | WP_003902441.1 | succinate dehydrogenase hydrophobic membrane anchor subunit | - |
OO115_RS03255 (OO115_03255) | 712874..713212 | - | 339 | WP_003417267.1 | succinate dehydrogenase, cytochrome b556 subunit | - |
OO115_RS03260 (OO115_03260) | 713449..713850 | + | 402 | WP_003417264.1 | cytidine deaminase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 143 a.a. Molecular weight: 15834.16 Da Isoelectric Point: 8.5471
>T264139 WP_003417282.1 NZ_CP110674:709244-709672 [Mycobacterium tuberculosis]
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
MRALLDVNVLLALLDRDHVDHERARAWITGQIERGWASCAITQNGFVRVISQPRYPSPISVAHAIDLLARATHTRYHEFW
SCTVSILDSKVIDRSRLHSPKQVTDAYLLALAVAHDGRFVTFDQSIALTAVPGATKQHLATL
Download Length: 429 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBL0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0TI59 |