Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 3534307..3534956 | Replicon | chromosome |
Accession | NZ_CP110673 | ||
Organism | Proteus mirabilis strain DP2019 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | OOZ57_RS16150 | Protein ID | WP_049256512.1 |
Coordinates | 3534307..3534726 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B4EZC0 |
Locus tag | OOZ57_RS16155 | Protein ID | WP_012368535.1 |
Coordinates | 3534723..3534956 (-) | Length | 78 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOZ57_RS16120 (OOZ57_16120) | 3529584..3530462 | - | 879 | WP_004246812.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
OOZ57_RS16125 (OOZ57_16125) | 3530638..3531552 | - | 915 | WP_004249085.1 | fatty acid biosynthesis protein FabY | - |
OOZ57_RS16130 (OOZ57_16130) | 3531576..3532013 | - | 438 | WP_004246810.1 | D-aminoacyl-tRNA deacylase | - |
OOZ57_RS16135 (OOZ57_16135) | 3532094..3532711 | - | 618 | WP_004246809.1 | glucose-1-phosphatase | - |
OOZ57_RS16140 (OOZ57_16140) | 3533365..3533781 | - | 417 | WP_049208252.1 | hypothetical protein | - |
OOZ57_RS16145 (OOZ57_16145) | 3533759..3534082 | - | 324 | WP_049208253.1 | hypothetical protein | - |
OOZ57_RS16150 (OOZ57_16150) | 3534307..3534726 | - | 420 | WP_049256512.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OOZ57_RS16155 (OOZ57_16155) | 3534723..3534956 | - | 234 | WP_012368535.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OOZ57_RS16160 (OOZ57_16160) | 3535223..3535375 | + | 153 | WP_162837551.1 | hypothetical protein | - |
OOZ57_RS16165 (OOZ57_16165) | 3535707..3537542 | - | 1836 | WP_004246802.1 | ribosome-dependent GTPase TypA | - |
OOZ57_RS16170 (OOZ57_16170) | 3537902..3539311 | + | 1410 | WP_004246801.1 | glutamate--ammonia ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15401.91 Da Isoelectric Point: 7.7288
>T264127 WP_049256512.1 NZ_CP110673:c3534726-3534307 [Proteus mirabilis]
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISTITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISTITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|