Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/Phd(antitoxin)
Location 3204021..3204568 Replicon chromosome
Accession NZ_CP110670
Organism Vibrio alginolyticus strain AUSMDU00064140

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag OPR71_RS14675 Protein ID WP_064377015.1
Coordinates 3204266..3204568 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A240ERD7
Locus tag OPR71_RS14670 Protein ID WP_039989820.1
Coordinates 3204021..3204278 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OPR71_RS14660 (OPR71_14660) 3199344..3201446 - 2103 WP_213889226.1 alpha-galactosidase -
OPR71_RS14665 (OPR71_14665) 3201678..3202739 + 1062 WP_064377016.1 LacI family DNA-binding transcriptional regulator -
OPR71_RS14670 (OPR71_14670) 3204021..3204278 + 258 WP_039989820.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
OPR71_RS14675 (OPR71_14675) 3204266..3204568 + 303 WP_064377015.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OPR71_RS14680 (OPR71_14680) 3204604..3204696 + 93 WP_081107514.1 DUF3265 domain-containing protein -
OPR71_RS14685 (OPR71_14685) 3204759..3205055 - 297 WP_140311992.1 type II toxin-antitoxin system RelE/ParE family toxin -
OPR71_RS14690 (OPR71_14690) 3205062..3205304 - 243 WP_064377013.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
OPR71_RS14695 (OPR71_14695) 3205417..3205509 + 93 WP_201785722.1 DUF3265 domain-containing protein -
OPR71_RS14700 (OPR71_14700) 3205544..3205939 + 396 WP_053306558.1 DUF3465 domain-containing protein -
OPR71_RS14705 (OPR71_14705) 3206090..3206548 + 459 WP_213889230.1 GNAT family N-acetyltransferase -
OPR71_RS14710 (OPR71_14710) 3206582..3207538 - 957 WP_033906599.1 IS110 family transposase -
OPR71_RS14715 (OPR71_14715) 3207759..3207851 + 93 WP_197649978.1 DUF3265 domain-containing protein -
OPR71_RS14720 (OPR71_14720) 3207884..3208420 + 537 WP_267922936.1 DUF1643 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - ugd / rfaD / wbtL 2962347..3216016 253669


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11699.59 Da        Isoelectric Point: 5.1765

>T264123 WP_064377015.1 NZ_CP110670:3204266-3204568 [Vibrio alginolyticus]
MAEIIWTEPALSDLNDIAEYITLENIVAAKQLVQTIFSKVERLQTFPESGRIPPELEHLSYREVVVNPCRVFYKQDGDKV
FILFVMRAERDLRKFLLSKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9620.12 Da        Isoelectric Point: 6.7269

>AT264123 WP_039989820.1 NZ_CP110670:3204021-3204278 [Vibrio alginolyticus]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHDEAKDKM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A240ERD7

References