Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 4215923..4216559 | Replicon | chromosome |
| Accession | NZ_CP110666 | ||
| Organism | Fictibacillus sp. KU28468 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | I8UKL4 |
| Locus tag | OKX00_RS22305 | Protein ID | WP_007200228.1 |
| Coordinates | 4215923..4216273 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A1I2FZG2 |
| Locus tag | OKX00_RS22310 | Protein ID | WP_053356092.1 |
| Coordinates | 4216278..4216559 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKX00_RS22270 (OKX00_22270) | 4211514..4212305 | - | 792 | WP_053356086.1 | RNA polymerase sigma factor SigB | - |
| OKX00_RS22275 (OKX00_22275) | 4212271..4212753 | - | 483 | WP_248251152.1 | anti-sigma B factor RsbW | - |
| OKX00_RS22280 (OKX00_22280) | 4212750..4213082 | - | 333 | WP_053356088.1 | STAS domain-containing protein | - |
| OKX00_RS22285 (OKX00_22285) | 4213144..4214151 | - | 1008 | WP_265408897.1 | PP2C family protein-serine/threonine phosphatase | - |
| OKX00_RS22290 (OKX00_22290) | 4214162..4214563 | - | 402 | WP_265408898.1 | anti-sigma regulatory factor | - |
| OKX00_RS22295 (OKX00_22295) | 4214566..4214931 | - | 366 | WP_175502007.1 | STAS domain-containing protein | - |
| OKX00_RS22300 (OKX00_22300) | 4214935..4215750 | - | 816 | WP_265408899.1 | STAS domain-containing protein | - |
| OKX00_RS22305 (OKX00_22305) | 4215923..4216273 | - | 351 | WP_007200228.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| OKX00_RS22310 (OKX00_22310) | 4216278..4216559 | - | 282 | WP_053356092.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| OKX00_RS22315 (OKX00_22315) | 4216747..4217892 | - | 1146 | WP_265408900.1 | alanine racemase | - |
| OKX00_RS22320 (OKX00_22320) | 4218028..4219062 | - | 1035 | WP_265408901.1 | outer membrane lipoprotein carrier protein LolA | - |
| OKX00_RS22325 (OKX00_22325) | 4219220..4219579 | - | 360 | WP_265410614.1 | holo-ACP synthase | - |
| OKX00_RS22330 (OKX00_22330) | 4219668..4220273 | + | 606 | WP_265408902.1 | rhomboid family intramembrane serine protease | - |
| OKX00_RS22335 (OKX00_22335) | 4220312..4220539 | + | 228 | WP_265408903.1 | hypothetical protein | - |
| OKX00_RS22340 (OKX00_22340) | 4220667..4220924 | - | 258 | WP_265408904.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13060.17 Da Isoelectric Point: 6.4714
>T264121 WP_007200228.1 NZ_CP110666:c4216273-4215923 [Fictibacillus sp. KU28468]
MIVKRGDVYFADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMRRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMRRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V8IRG1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1I2FZG2 |