Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pemIK/MazF(toxin)
Location 4215923..4216559 Replicon chromosome
Accession NZ_CP110666
Organism Fictibacillus sp. KU28468

Toxin (Protein)


Gene name pemK Uniprot ID I8UKL4
Locus tag OKX00_RS22305 Protein ID WP_007200228.1
Coordinates 4215923..4216273 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name pemI Uniprot ID A0A1I2FZG2
Locus tag OKX00_RS22310 Protein ID WP_053356092.1
Coordinates 4216278..4216559 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OKX00_RS22270 (OKX00_22270) 4211514..4212305 - 792 WP_053356086.1 RNA polymerase sigma factor SigB -
OKX00_RS22275 (OKX00_22275) 4212271..4212753 - 483 WP_248251152.1 anti-sigma B factor RsbW -
OKX00_RS22280 (OKX00_22280) 4212750..4213082 - 333 WP_053356088.1 STAS domain-containing protein -
OKX00_RS22285 (OKX00_22285) 4213144..4214151 - 1008 WP_265408897.1 PP2C family protein-serine/threonine phosphatase -
OKX00_RS22290 (OKX00_22290) 4214162..4214563 - 402 WP_265408898.1 anti-sigma regulatory factor -
OKX00_RS22295 (OKX00_22295) 4214566..4214931 - 366 WP_175502007.1 STAS domain-containing protein -
OKX00_RS22300 (OKX00_22300) 4214935..4215750 - 816 WP_265408899.1 STAS domain-containing protein -
OKX00_RS22305 (OKX00_22305) 4215923..4216273 - 351 WP_007200228.1 type II toxin-antitoxin system endoribonuclease NdoA Toxin
OKX00_RS22310 (OKX00_22310) 4216278..4216559 - 282 WP_053356092.1 ribbon-helix-helix protein, CopG family Antitoxin
OKX00_RS22315 (OKX00_22315) 4216747..4217892 - 1146 WP_265408900.1 alanine racemase -
OKX00_RS22320 (OKX00_22320) 4218028..4219062 - 1035 WP_265408901.1 outer membrane lipoprotein carrier protein LolA -
OKX00_RS22325 (OKX00_22325) 4219220..4219579 - 360 WP_265410614.1 holo-ACP synthase -
OKX00_RS22330 (OKX00_22330) 4219668..4220273 + 606 WP_265408902.1 rhomboid family intramembrane serine protease -
OKX00_RS22335 (OKX00_22335) 4220312..4220539 + 228 WP_265408903.1 hypothetical protein -
OKX00_RS22340 (OKX00_22340) 4220667..4220924 - 258 WP_265408904.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(4-111)

Antitoxin

Ribbon-helix-helix protein, CopG

(9-45)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13060.17 Da        Isoelectric Point: 6.4714

>T264121 WP_007200228.1 NZ_CP110666:c4216273-4215923 [Fictibacillus sp. KU28468]
MIVKRGDVYFADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMRRVDEALQISLGLIDF

Download         Length: 351 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10916.65 Da        Isoelectric Point: 7.2048

>AT264121 WP_053356092.1 NZ_CP110666:c4216559-4216278 [Fictibacillus sp. KU28468]
VSELANTKRIVISLPQQIINEVDRMIKNENLDRSEFIHQATKMYIREKKKRHIRESMRQGYMEMAKINLNIASEAFLLEE
EAEITLDRLVSGV

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0V8IRG1

Antitoxin

Source ID Structure
AlphaFold DB A0A1I2FZG2

References