Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-YefM |
Location | 2124920..2125635 | Replicon | chromosome |
Accession | NZ_CP110664 | ||
Organism | Actinobacillus pleuropneumoniae strain AP_123 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OOL18_RS10295 | Protein ID | WP_052245676.1 |
Coordinates | 2124920..2125285 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | B0BT01 |
Locus tag | OOL18_RS10300 | Protein ID | WP_005599447.1 |
Coordinates | 2125348..2125635 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOL18_RS10280 | 2120505..2122211 | - | 1707 | WP_237592765.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
OOL18_RS10285 | 2122307..2122588 | - | 282 | WP_005599441.1 | DNA-directed RNA polymerase subunit omega | - |
OOL18_RS10290 | 2122715..2124796 | - | 2082 | WP_265410815.1 | ATP-dependent DNA helicase RecG | - |
OOL18_RS10295 | 2124920..2125285 | - | 366 | WP_052245676.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OOL18_RS10300 | 2125348..2125635 | - | 288 | WP_005599447.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OOL18_RS10305 | 2125841..2127556 | + | 1716 | WP_039709409.1 | proline--tRNA ligase | - |
OOL18_RS10310 | 2127622..2127810 | - | 189 | WP_005602684.1 | hypothetical protein | - |
OOL18_RS10315 | 2127813..2128394 | - | 582 | WP_005606496.1 | sigma-70 family RNA polymerase sigma factor | - |
OOL18_RS10320 | 2128483..2129439 | + | 957 | WP_005619040.1 | protein-methionine-sulfoxide reductase catalytic subunit MsrP | - |
OOL18_RS10325 | 2129439..2130032 | + | 594 | WP_005599453.1 | protein-methionine-sulfoxide reductase heme-binding subunit MsrQ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14015.04 Da Isoelectric Point: 7.9017
>T264120 WP_052245676.1 NZ_CP110664:c2125285-2124920 [Actinobacillus pleuropneumoniae]
IDTNVRQWLETIKPSQTNISCITLSEIKTGILLKARKDPIQAERLNHWFTHDVLSVYQAKSFSINNEIALLASEYHIPNK
MDLNDAYIAATAKYHNLVLVTRNLKDFNRCDIRLFNPFEPN
IDTNVRQWLETIKPSQTNISCITLSEIKTGILLKARKDPIQAERLNHWFTHDVLSVYQAKSFSINNEIALLASEYHIPNK
MDLNDAYIAATAKYHNLVLVTRNLKDFNRCDIRLFNPFEPN
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|