Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 2028339..2028967 | Replicon | chromosome |
Accession | NZ_CP110664 | ||
Organism | Actinobacillus pleuropneumoniae strain AP_123 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OOL18_RS09700 | Protein ID | WP_005609156.1 |
Coordinates | 2028569..2028967 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | OOL18_RS09695 | Protein ID | WP_039709385.1 |
Coordinates | 2028339..2028569 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOL18_RS09685 | 2026187..2027620 | + | 1434 | WP_265410803.1 | hypothetical protein | - |
OOL18_RS09690 | 2028091..2028231 | - | 141 | WP_162835170.1 | hypothetical protein | - |
OOL18_RS09695 | 2028339..2028569 | + | 231 | WP_039709385.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
OOL18_RS09700 | 2028569..2028967 | + | 399 | WP_005609156.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
OOL18_RS09705 | 2029102..2029518 | - | 417 | WP_215577975.1 | DUF417 family protein | - |
OOL18_RS09710 | 2029764..2030414 | + | 651 | WP_005605765.1 | DUF2202 domain-containing protein | - |
OOL18_RS09715 | 2030487..2031146 | - | 660 | WP_265410804.1 | hypothetical protein | - |
OOL18_RS09720 | 2031460..2032782 | - | 1323 | WP_005620148.1 | HslU--HslV peptidase ATPase subunit | - |
OOL18_RS09725 | 2032928..2033449 | - | 522 | WP_005599247.1 | ATP-dependent protease subunit HslV | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2007215..2044383 | 37168 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15066.37 Da Isoelectric Point: 7.3824
>T264119 WP_005609156.1 NZ_CP110664:2028569-2028967 [Actinobacillus pleuropneumoniae]
MLTYMLDTNIAIYVIKRRPIEVLDKFNLNSTRLCVSSITAAELYYGAEKSQFPERNMAVIEDFLSRLTILDYTHKAATHF
GNIKAHLSKCGKILGENDIHIAAHARSEGLVLVTNNLREFERVEGLRLDNWV
MLTYMLDTNIAIYVIKRRPIEVLDKFNLNSTRLCVSSITAAELYYGAEKSQFPERNMAVIEDFLSRLTILDYTHKAATHF
GNIKAHLSKCGKILGENDIHIAAHARSEGLVLVTNNLREFERVEGLRLDNWV
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|