Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1805205..1805936 | Replicon | chromosome |
| Accession | NZ_CP110664 | ||
| Organism | Actinobacillus pleuropneumoniae strain AP_123 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | OOL18_RS08565 | Protein ID | WP_005598840.1 |
| Coordinates | 1805205..1805672 (-) | Length | 156 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | B0BRD3 |
| Locus tag | OOL18_RS08570 | Protein ID | WP_005619269.1 |
| Coordinates | 1805676..1805936 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOL18_RS08540 | 1800565..1800936 | - | 372 | WP_005598830.1 | CrcB family protein | - |
| OOL18_RS08545 | 1800939..1802003 | - | 1065 | WP_039709309.1 | MFS transporter | - |
| OOL18_RS08550 | 1802098..1803207 | + | 1110 | WP_039709310.1 | anhydro-N-acetylmuramic acid kinase | - |
| OOL18_RS08555 | 1803260..1804174 | + | 915 | WP_005598836.1 | N-acetylmuramic acid 6-phosphate etherase | - |
| OOL18_RS08560 | 1804241..1805122 | - | 882 | WP_265410754.1 | 50S ribosomal protein L11 methyltransferase | - |
| OOL18_RS08565 | 1805205..1805672 | - | 468 | WP_005598840.1 | GNAT family N-acetyltransferase | Toxin |
| OOL18_RS08570 | 1805676..1805936 | - | 261 | WP_005619269.1 | DUF1778 domain-containing protein | Antitoxin |
| OOL18_RS08575 | 1806057..1807517 | - | 1461 | WP_005598844.1 | metalloprotease TldD | - |
| OOL18_RS08580 | 1807647..1808906 | + | 1260 | WP_005608887.1 | tRNA lysidine(34) synthetase TilS | - |
| OOL18_RS08585 | 1808933..1809223 | - | 291 | WP_005598848.1 | DUF5389 family protein | - |
| OOL18_RS08590 | 1809225..1810118 | - | 894 | WP_005608892.1 | site-specific tyrosine recombinase XerD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17206.22 Da Isoelectric Point: 8.9312
>T264118 WP_005598840.1 NZ_CP110664:c1805672-1805205 [Actinobacillus pleuropneumoniae]
MHAPELLSEQHIVRYFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDENKQVMGFYCLSAGSVSHQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGIKALLVHALNPQAKQFYLKYGFSCSPIDEMVLMLKL
MHAPELLSEQHIVRYFQCGEVVLDQWLQRTALKNQQNNASKTFVVCDENKQVMGFYCLSAGSVSHQFVAGALRRNMPDPI
PVIILGRLAVDCSAQGKQLGVSMLKDAVLKSKTVANQIGIKALLVHALNPQAKQFYLKYGFSCSPIDEMVLMLKL
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|