Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | toxTA/Tad-couple_hipB |
Location | 1597916..1598561 | Replicon | chromosome |
Accession | NZ_CP110664 | ||
Organism | Actinobacillus pleuropneumoniae strain AP_123 |
Toxin (Protein)
Gene name | toxT | Uniprot ID | B0BQU7 |
Locus tag | OOL18_RS07520 | Protein ID | WP_005619674.1 |
Coordinates | 1598190..1598561 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | OOL18_RS07515 | Protein ID | WP_005598477.1 |
Coordinates | 1597916..1598209 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOL18_RS07485 | 1593248..1593931 | - | 684 | WP_005605188.1 | arginine ABC transporter permease ArtM | - |
OOL18_RS07490 | 1593931..1594602 | - | 672 | WP_005608588.1 | arginine ABC transporter permease ArtQ | - |
OOL18_RS07495 | 1594608..1595327 | - | 720 | WP_005619670.1 | transporter substrate-binding domain-containing protein | - |
OOL18_RS07500 | 1595347..1596081 | - | 735 | WP_005598473.1 | arginine ABC transporter ATP-binding protein ArtP | - |
OOL18_RS07505 | 1596306..1596803 | - | 498 | WP_005601953.1 | YbhB/YbcL family Raf kinase inhibitor-like protein | - |
OOL18_RS07510 | 1596876..1597838 | + | 963 | WP_005619672.1 | calcium/sodium antiporter | - |
OOL18_RS07515 | 1597916..1598209 | - | 294 | WP_005598477.1 | helix-turn-helix domain-containing protein | Antitoxin |
OOL18_RS07520 | 1598190..1598561 | - | 372 | WP_005619674.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OOL18_RS07525 | 1598754..1600505 | + | 1752 | WP_237610232.1 | protein-disulfide reductase DsbD | - |
OOL18_RS07530 | 1600563..1601132 | + | 570 | WP_005598484.1 | elongation factor P hydroxylase | - |
OOL18_RS07535 | 1601176..1602030 | - | 855 | WP_005598486.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 15066.57 Da Isoelectric Point: 10.4054
>T264117 WP_005619674.1 NZ_CP110664:c1598561-1598190 [Actinobacillus pleuropneumoniae]
MYEIVFYRDKRGREPVKEFLLRLLKERQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKQNYRIPKREIERAKVRLADLQERIKDEPYWF
MYEIVFYRDKRGREPVKEFLLRLLKERQEGSRERLHKISHHLSILHLHGTRAGENYIKHLEDRIWQLRPVGDCLLFASII
RGKFVLLHYFAKQNYRIPKREIERAKVRLADLQERIKDEPYWF
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|