Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YoeB-YefM |
Location | 1503096..1503604 | Replicon | chromosome |
Accession | NZ_CP110664 | ||
Organism | Actinobacillus pleuropneumoniae strain AP_123 |
Toxin (Protein)
Gene name | relE | Uniprot ID | B0BQK9 |
Locus tag | OOL18_RS07035 | Protein ID | WP_005605064.1 |
Coordinates | 1503344..1503604 (+) | Length | 87 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | B0BQK8 |
Locus tag | OOL18_RS07030 | Protein ID | WP_005598318.1 |
Coordinates | 1503096..1503347 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OOL18_RS06990 | 1498632..1499180 | - | 549 | WP_237593742.1 | type IV pilus biogenesis/stability protein PilW | - |
OOL18_RS06995 | 1499234..1500415 | - | 1182 | WP_005608495.1 | bifunctional tRNA (adenosine(37)-C2)-methyltransferase TrmG/ribosomal RNA large subunit methyltransferase RlmN | - |
OOL18_RS07020 | 1501319..1502758 | + | 1440 | WP_005608501.1 | glutamate--tRNA ligase | - |
OOL18_RS07030 | 1503096..1503347 | + | 252 | WP_005598318.1 | YoeB-YefM toxin-antitoxin system antitoxin YefM | Antitoxin |
OOL18_RS07035 | 1503344..1503604 | + | 261 | WP_005605064.1 | Txe/YoeB family addiction module toxin | Toxin |
OOL18_RS07040 | 1503763..1503930 | - | 168 | WP_005598320.1 | Trm112 family protein | - |
OOL18_RS07045 | 1503932..1504912 | - | 981 | WP_005608502.1 | tetraacyldisaccharide 4'-kinase | - |
OOL18_RS07050 | 1505006..1506265 | - | 1260 | WP_005598324.1 | ATP-dependent protease ATP-binding subunit ClpX | - |
OOL18_RS07055 | 1506265..1506855 | - | 591 | WP_005598326.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | - |
OOL18_RS07060 | 1506977..1507369 | + | 393 | WP_005620423.1 | SufE family protein | - |
OOL18_RS07075 | 1507740..1508501 | - | 762 | WP_039709246.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 87 a.a. Molecular weight: 10423.99 Da Isoelectric Point: 8.0109
>T264116 WP_005605064.1 NZ_CP110664:1503344-1503604 [Actinobacillus pleuropneumoniae]
MKLTFSSNAWEDYLYWQKTDKIILKRINSLIKDIQRQPFEGIGKLEPLKFNLSGFWSRRINEEHRLIYSVEDEAILIVAC
RYHYDQ
MKLTFSSNAWEDYLYWQKTDKIILKRINSLIKDIQRQPFEGIGKLEPLKFNLSGFWSRRINEEHRLIYSVEDEAILIVAC
RYHYDQ
Download Length: 261 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|