Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 242679..243201 | Replicon | plasmid pB431_1 |
| Accession | NZ_CP110662 | ||
| Organism | Klebsiella pneumoniae strain B431 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
| Locus tag | OOS97_RS26355 | Protein ID | WP_004181778.1 |
| Coordinates | 242917..243201 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
| Locus tag | OOS97_RS26350 | Protein ID | WP_004181777.1 |
| Coordinates | 242679..242927 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOS97_RS26330 (OOS97_26330) | 237888..238709 | - | 822 | WP_004181772.1 | hypothetical protein | - |
| OOS97_RS26335 (OOS97_26335) | 238771..239124 | - | 354 | WP_004181774.1 | hypothetical protein | - |
| OOS97_RS26340 (OOS97_26340) | 239269..240255 | - | 987 | WP_025368599.1 | hypothetical protein | - |
| OOS97_RS26345 (OOS97_26345) | 240589..242388 | - | 1800 | WP_004181776.1 | ATP-dependent helicase | - |
| OOS97_RS26350 (OOS97_26350) | 242679..242927 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OOS97_RS26355 (OOS97_26355) | 242917..243201 | + | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OOS97_RS26360 (OOS97_26360) | 243218..243319 | - | 102 | Protein_265 | IS200/IS605 family transposase | - |
| OOS97_RS26365 (OOS97_26365) | 243355..244581 | + | 1227 | WP_040209639.1 | RNA-guided endonuclease TnpB family protein | - |
| OOS97_RS26370 (OOS97_26370) | 244852..245076 | - | 225 | Protein_267 | transposase | - |
| OOS97_RS26375 (OOS97_26375) | 245155..245583 | - | 429 | WP_077257669.1 | IS200/IS605 family transposase | - |
| OOS97_RS26380 (OOS97_26380) | 245619..246806 | + | 1188 | WP_040209642.1 | RNA-guided endonuclease TnpB family protein | - |
| OOS97_RS26385 (OOS97_26385) | 246851..247222 | - | 372 | WP_040209644.1 | hypothetical protein | - |
| OOS97_RS26390 (OOS97_26390) | 247219..247563 | - | 345 | WP_223811496.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(A) / aph(3')-Ia / aac(3)-IId / sul1 / qacE / aadA16 / dfrA27 / ARR-3 | pla | 1..315621 | 315621 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T264115 WP_004181778.1 NZ_CP110662:242917-243201 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0S6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0U8 |