Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 4904732..4905542 | Replicon | chromosome |
| Accession | NZ_CP110661 | ||
| Organism | Klebsiella pneumoniae strain B431 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | A0A332NV98 |
| Locus tag | OOS97_RS23755 | Protein ID | WP_014908042.1 |
| Coordinates | 4905009..4905542 (+) | Length | 178 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | - |
| Locus tag | OOS97_RS23750 | Protein ID | WP_023343051.1 |
| Coordinates | 4904732..4904998 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOS97_RS23730 (4900603) | 4900603..4900947 | - | 345 | WP_004192220.1 | cation efflux system protein CusF | - |
| OOS97_RS23735 (4900965) | 4900965..4902350 | - | 1386 | WP_024623207.1 | efflux transporter outer membrane subunit | - |
| OOS97_RS23740 (4902523) | 4902523..4903206 | + | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
| OOS97_RS23745 (4903196) | 4903196..4904629 | + | 1434 | WP_023343050.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
| OOS97_RS23750 (4904732) | 4904732..4904998 | + | 267 | WP_023343051.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
| OOS97_RS23755 (4905009) | 4905009..4905542 | + | 534 | WP_014908042.1 | type II toxin-antitoxin system toxin KacT | Toxin |
| OOS97_RS23760 (4905590) | 4905590..4906711 | - | 1122 | WP_012737335.1 | cupin domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19795.68 Da Isoelectric Point: 5.2614
>T264113 WP_014908042.1 NZ_CP110661:4905009-4905542 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGLGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGLGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|